Jeong Jaehyun Smut - Tumblr Posts
faded (사라졌다) — jeong jaehyun (정재현)

✧.* 18+
in the dim light of the abandoned warehouse, shadows wove intricate patterns across the walls, a testament to the broken windows and the remnants of long-forgotten machinery. the air was thick with the pungent odor of decay, and the floor was strewn with shattered glass and rusting metal scraps. amid this desolation, a figure moved with an unsettling grace, a quiet elegance that seemed incongruous with the setting.
his eyes, sharp and cold, scanned the room with a calculated detachment. they were like twin shards of ice, reflecting a mind that saw the world not as a tapestry of human experiences but as a cold, dispassionate experiment. he was a sociopath, a term that had been plastered across his dossier and whispered among his colleagues, yet the reality of it was far more profound than any clinical definition.
to observe him was to witness the eerie beauty of a machine in motion, devoid of the warmth that usually defined human interactions. his movements were precise, almost mechanical, each step measured and deliberate. the absence of empathy was not merely a gap but an abyss where emotions should have been. when he spoke, his voice was smooth and calculated, a perfect instrument of persuasion devoid of the imperfections of genuine human emotion. his words were delivered with a chilling calmness that could disarm and manipulate with equal ease.
yet, in his eyes, there was something more than mere coldness—a profound emptiness that spoke of a soul stripped of emotional resonance. it was as if he viewed the world through a glass barrier, witnessing the intricacies of human suffering and joy without ever truly engaging with them. this detachment granted him a chilling clarity, allowing him to observe and exploit the weaknesses of others with unnerving efficiency. he could mimic the gestures of kindness and concern, but they were nothing more than hollow echoes of what he could not feel.
the warehouse was his sanctuary, a place where he could revel in his isolation and indulge in the dark thoughts that occupied his mind. here, away from the prying eyes of society, he was free to dissect the nature of his own being and the roles he played. in the flickering light of a solitary bulb, he contemplated the human condition with a dispassionate curiosity. the contradictions of his existence fascinated him—how he could so easily simulate emotions he could never truly experience, how he could manipulate others with a mere flicker of charm, and how he remained untouched by the very forces that drove others to despair or elation.
as he stood amidst the debris, a sense of profound solitude enveloped him. He was a being of intellect and precision, existing in a world of feelings he could never truly grasp. his mind was a labyrinth of strategy and calculation, each thought meticulously honed to serve his purpose. he was a creature of logic in a realm of chaos, a master of a game whose rules he understood but whose essence remained forever beyond his reach.
and yet, despite this chilling detachment, there was an undeniable truth that lingered in the shadows of his consciousness. beneath the veneer of calculated indifference and the mask of emotional vacancy, he was still human. his actions, though devoid of conventional empathy, were driven by a deeply rooted sense of self-preservation and a pursuit of his own desires. in his solitary reflections, there was a flicker of the same existential questioning that plagued the rest of humanity—a search for meaning, a quest for identity, and a confrontation with his own mortality.
in that abandoned warehouse, amidst the debris of a world he navigated with clinical precision, the true nature of his humanity lay bare. it was not in the warmth of human connection or the depth of emotional engagement but in the quiet recognition of his own existence. he was still bound by the same inescapable truths that defined all humans—the quest for understanding, the struggle for control, and the inevitable confrontation with his own limitations. it became clear that despite his chilling detachment and calculated demeanor, he was still human, after all.
jeong jaehyun stumbled out of the warehouse, the weight of his actions pulling him down like a leaden shroud. the night air was crisp and harsh against his skin, a stark contrast to the suffocating gloom he had just escaped. his hands, stained with fresh blood, trembled uncontrollably as he stared at them in horror. the crimson splatters seemed to mock him, painting a grotesque tableau of the violence that had just transpired. each step he took was uncertain, as if the ground beneath him could give way at any moment. his mind raced, trying to make sense of the chaos, but the cold, rational part of him remained eerily detached.
as he wandered onto the street, his disheveled figure moving erratically, a car approached in the distance. jaehyun's gaze was fixed on the bloodied hands, his thoughts mired in a growing sense of doom. the headlights of the car grew brighter, and he vaguely registered the sound of its engine roaring closer. to him, it seemed as though the man in the sky was reaching down to punish him for his sins, an abstract punishment for a crime he felt he could never fully comprehend.
the car’s headlights blinded him as it neared, and with a sudden, frantic lurch, he realized he was standing in the middle of the road. instinctively, he threw up his hands, but the vehicle did not slow. the screech of tires and a sharp, agonized honk pierced the night as you slammed the brakes, narrowly avoiding hitting him. the car skidded to a stop, its headlights illuminating his battered form.
your eyes widened in shock as you took in the sight before you. you rushed out of the car, your heart pounding with adrenaline. jaehyun, in his state of shock and confusion, flinched as you approached. he was convinced that you were another threat, someone who had come to finish what had been started. but as you drew closer, your gaze softening with unexpected concern, he was taken aback.
“get in the car,” you said abruptly, ignoring his stunned expression and the blood on his hands. your tone was calm, almost serene, a stark contrast to the tension that crackled in the air. he stared at you, bewildered. “who are you?”
you didn’t respond immediately. instead, you gestured toward the open car door, a silent invitation. with no better options and an overwhelming sense of dread, he climbed into the back seat, his movements slow and hesitant. as you slid back into the driver’s seat and shut the door, you glanced at him through the rearview mirror. your eyes met his, and to his utter disbelief, you smiled. “why are you helping me?” he asked, his voice barely above a whisper, laden with disbelief. “it’s good karma,” you replied with a gentle, enigmatic smile.
jaehyun stared at you in stunned silence, the absurdity of the situation washing over him. “it’s hard to believe you’d help a stranger everyone wants dead.” you chuckled softly, the sound almost musical. “well, you’d have to keep that a secret. my brother’s a cop.” for the past month, his face had been plastered on the screen of every news channel imaginable, as he had been one of the prime suspects regarding the suicide of a high school teacher. one that turned out to be a homicide in disguise.
his eyes widened in shock, and a heavy silence filled the car. you glanced back at his bloodied hands in the mirror. “you must’ve done it, judging by what just happened,” you said. he shook his head vehemently. “i didn’t do it,” he said, his voice raw and earnest. “i didn’t kill anyone. i gave the guy a good beating, that’s all.”
you smiled softly as you turned into your driveway, the car coming to a smooth halt. “he must’ve deserved it,” you said, your tone light and almost amused. jaehyun sat in stunned silence, his thoughts swirling in a tempest of confusion and fear. as the car settled, he looked at you, a mixture of gratitude and wariness in his eyes. in this fleeting encounter, he had found a peculiar semblance of solace, a stark contrast to the chaos that had so recently defined his life.
you guided jaehyun into your home, your hand gentle yet firm on his arm as he stumbled over the threshold. the dim lighting of your hallway cast long shadows, but there was a warmth in the air that contrasted sharply with the cold, sterile atmosphere of the warehouse he had just left behind. his breath came in short, ragged gasps, and he could feel the weight of the night pressing down on him, thick and suffocating.
“don’t worry,” you said softly, catching his wary glance toward the door. “my brother’s working the night shift. we won’t be disturbed.”
his skepticism lingered in his eyes, a dark cloud of doubt that refused to dissipate. but he nodded, too exhausted and disoriented to argue. you led him further inside, the soft creak of the floorboards the only sound that accompanied your footsteps. the house was modest, cozy, with a lived-in feel that suggested safety, a stark contrast to the barren emptiness he had known for so long. there were framed photos on the walls—smiling faces, captured memories that spoke of a life filled with love and warmth. it was a world so foreign to him, yet so alluring in its simplicity.
you brought him into the bathroom, the light flickering on with a quiet hum. the stark white of the tiles seemed almost too bright against the dark stains on his hands, a brutal reminder of the violence that had so recently unfolded. you turned on the faucet, the water rushing forth in a steady stream, and guided his hands beneath it. the warmth of the water was soothing against his skin, but it did little to wash away the guilt that gnawed at the edges of his mind.
as you gently scrubbed his hands, he watched you intently, his eyes never leaving your face. there was a calm determination in your expression, a focus that belied the gravity of the situation. you didn’t flinch at the sight of the blood, nor did you recoil in fear. instead, you worked methodically, your touch gentle and sure, as if this were the most natural thing in the world. mever had he encountered someone so sympathetic, so willing to help without question, so utterly fearless in the face of danger.
when his hands were finally clean, you handed him a towel, your fingers brushing against his as you did so. “come with me,” you said, your voice soft and inviting. he followed you down the hallway, past the living room where a small lamp cast a warm glow over the furniture, and into a bedroom. you opened the closet, pulling out one of your brother’s shirts—a simple white button-down, clean and neatly folded. “here,” you said, handing it to him. “it should fit you.”
jaehyun hesitated, the shirt hanging limply from his grasp. “why are you doing this?” he asked, his voice low, almost a whisper. you looked up at him, your eyes meeting his. there was no fear in your gaze, only a quiet understanding that seemed to pierce through the layers of detachment he had built around himself. “because you need help,” you replied simply. “and because i can.”
he studied your face, searching for any sign of deceit or ulterior motive, but found none. there was only sincerity, a rare and precious thing in his world. with a nod, he began to change, his movements slow and deliberate, as if he were testing the reality of the situation. you turned your back to give him privacy, busying yourself with gathering the discarded clothes. he slipped into the shirt, the fabric cool against his skin, and as he buttoned it up, he couldn’t help but feel a strange sense of comfort—a sensation he hadn’t experienced in what felt like a lifetime.
once he was dressed, he looked at you, a question lingering on his lips. “how are you so sure i won’t kill you?” you turned to face him, that same soft smile playing on your lips. “because i know you’re not a killer,” you said, your tone light yet firm, as if the idea was the most obvious truth in the world.
the words struck him like a bolt of lightning, sending a shockwave through his mind. never had he heard those words before—words of belief, of trust. they resonated deep within him, filling a void he hadn’t realized existed. for so long, he had been defined by what others saw in him, by the darkness they projected onto him, but in this moment, you saw something different. and god, did it feel good to hear those words.
you led him to the kitchen next, the warm, inviting space filled with the faint scent of spices and home-cooked meals. he sat down at the table, his body tense and alert, while you moved around the kitchen with practiced ease. the sound of pots and pans clinking together, the hiss of the stove as you lit the burner, the gentle hum of the refrigerator—it all blended into a soothing symphony that lulled his mind into a state of wary calm.
as you cooked, he watched you closely, unable to tear his eyes away. there was a grace to your movements, a quiet confidence that radiated from you. It fascinated him, this effortless display of empathy and care. he wondered how someone could be so willing to help, so fearless for their own safety, when he had seen the worst of humanity.
you placed a simple meal in front of him—a bowl of soup, steaming hot, with a slice of bread on the side. the aroma was comforting, a reminder of something he couldn’t quite place, something from a past life that felt more like a distant dream. he hadn’t realized how hungry he was until the smell hit his senses, and his stomach tightened in response.
“thank you,” he said quietly, almost as if the words were foreign to him.
you smiled, watching him as he took his first hesitant bite. there was a vulnerability in his expression, a flicker of something you couldn’t quite name. you studied his face, the sharp lines of his jaw, the intensity in his eyes, and wondered how someone could seem to lack so much empathy. what had shaped him into this detached, calculating figure? what had stripped away the warmth and left only coldness behind? but despite the questions swirling in your mind, you didn’t pry. you simply let him eat in peace, your presence a quiet reassurance in the background.
when he was finished, you took the dishes away, your movements gentle and unhurried. the night was wearing on, and you could see the exhaustion etched into his features, the weight of the day pressing down on him like a heavy burden. you led him to a small guest room, the bed neatly made with fresh linens. it was a modest space, but it was warm and inviting, a stark contrast to the cold, sterile environments he was used to. “i’ve made up the bed for you,” you said, smoothing out the blankets one last time. “you should get some rest.”
he stood there, hesitant, as if the idea of sleep was something foreign to him. but as he looked at you, your kindness and calm demeanor slowly chipping away at his defenses, he nodded. “thank you,” he said again, the words feeling more natural this time, though still tinged with disbelief.
you gave him one last smile before stepping out of the room, closing the door softly behind you. the silence that followed was almost deafening, and as jaehyun sat on the edge of the bed, his mind raced. he couldn’t rest, not with the chaos swirling in his thoughts. the events of the night replayed over and over, but now they were interwoven with images of you—your calm smile, your gentle touch, your unwavering belief that he was something more than what the world saw.
he lay down, staring up at the ceiling, but sleep refused to come. the bed was too soft, too comfortable, and his mind was too restless. he turned over, his eyes drifting to the door, half-expecting you to return, to tell him it had all been a mistake, that you had seen him for what he really was—a monster, a sociopath, someone incapable of true human connection. but the door remained closed, and the only sound was the faint hum of the house settling around him. in the stillness of the night, jaehyun’s thoughts were consumed by you—his unlikely savior. he couldn’t understand it, couldn’t comprehend why you had helped him, why you had risked so much for someone like him. the warmth of your smile lingered in his mind, a beacon in the darkness that threatened to engulf him. and as he lay there, staring into the void, he realized that for the first time in a long while, he felt something. it wasn’t quite hope, but it was close—a faint glimmer of something better, something he had long since forgotten.
but sleep still eluded him. his mind raced with thoughts of you, and the fear that it was all too good to be true gnawed at him. he couldn’t shake the feeling that this kindness, this sanctuary, would vanish as quickly as it had appeared. but for now, in this quiet room, he allowed himself to believe, if only for a moment, that he wasn’t completely alone in the world.
jaehyun awoke to the soft light of dawn filtering through the thin curtains, casting delicate shadows across the room. for a moment, he remained still, his mind drifting in the hazy space between sleep and wakefulness. the events of the previous night felt like fragments of a distant dream, too surreal to be real. but as he blinked the sleep from his eyes, the solid reality of his surroundings began to settle in. the warmth of the bed beneath him, the quiet hum of the house, the faint scent of something comforting in the air—it all grounded him, pulling him back to the present.
he turned his head slightly and saw you standing in the doorway, your presence calm and reassuring. you were watching him with a soft smile, as if you had been waiting for him to wake up. the sight of you, so real and tangible, dispelled any lingering doubt he had. this wasn’t a dream. you were real. the kindness you had shown him, the safety you had provided—it was all real.
“good morning,” you greeted him softly, your voice a gentle lull in the quiet room. jaehyun sat up slowly, his body still stiff and sore from the night before. “morning,” he replied, his voice rough from sleep. he hesitated, unsure of what to say next. the words felt heavy on his tongue, weighed down by the unfamiliarity of expressing gratitude. but when he looked into your eyes, the sincerity there made it easier. “thank you, again.”
you shook your head, a small smile playing on your lips. “there’s no need to thank me, kaehyun. i’m just glad you’re okay.” there was a pause, a silence that felt both comforting and heavy with unspoken words. he broke it first, glancing at the clock on the wall. “i should get going. i have a busy day ahead of me.”
you nodded, understanding, though there was a hint of concern in your eyes. “qre you sure you don’t want any breakfast before you go? it’s no trouble at all.” he shook his head, standing up from the bed and straightening his borrowed shirt. “no, i need to get moving. but i appreciate the offer.”
you walked him to the door, the quiet of the morning enveloping you both as you stepped into the hallway. “take care of yourself,” you said, your voice filled with genuine concern. “i’ll see you around?” jaehyun paused at the doorway, turning to look at you one last time. there was something in your eyes, something that tugged at a place deep inside him that he had long thought dead. he didn’t know how to respond, didn’t know how to make sense of the connection that seemed to have formed between you in such a short span of time. but he nodded, the gesture small but full of unspoken meaning. “yeah,” he said finally, his voice quiet. “i’ll see you around.”
with that, he stepped out into the cool morning air, the door closing softly behind him. the world outside was still waking up, the streets quiet and the sky painted with the soft hues of dawn. as he walked, the events of the previous night replayed in his mind, each step taking him further from your home but not from the thoughts of you. your kindness lingered with him, a warmth that refused to fade even as the cold morning air bit at his skin.
as jaehyun made his way down the street, lost in his thoughts, he didn’t notice the car approaching from behind until it slowed down beside him. he glanced over, his eyes locking with those of the driver—a man with a stern expression, his gaze sharp and scrutinizing. there was something familiar about him, something that sent a shiver down his spine. the man’s eyes flicked down to the shirt jaehyun was wearing, recognition dawning in his features. it was your brother.
the moment seemed to stretch on forever, the tension between them palpable in the air. jaehyun’s heart pounded in his chest, the sudden realization that your brother knew who he was, and more importantly, what he was suspected of. he could see the gears turning in your brother’s mind, the connection being made between the shirt jaehyun wore and the one hanging in your brother’s closet. it was a small detail, but it spoke volumes.
the car sped off, leaving jaehyun standing in the middle of the sidewalk, a chill running down his spine that had nothing to do with the morning air. he cursed under his breath, realizing the trouble that was now headed your way. but what could he do? what could he say that would make a difference? he shook his head, forcing himself to keep walking, but the image of your brother’s piercing gaze stayed with him, a stark reminder that his problems were far from over.
meanwhile, your brother drove in silence, his mind racing with thoughts of you and the man he had just seen wearing his shirt. his knuckles were white as he gripped the steering wheel, his mind filled with the gruesome images from the case that had been haunting him for weeks—the case he was sure jaehyun was involved in. he couldn’t shake the feeling that something was terribly wrong, that you were in danger, and it was all because of that man.
he pulled into the driveway with a screech, his anger bubbling just below the surface as he stepped out of the car. he slammed the door shut and marched into the house, his footsteps heavy and filled with purpose. the moment he saw you in the kitchen, his eyes narrowed, his voice laced with barely contained fury.
“were you with him?” he demanded, his tone sharp and accusing. you turned to face him, surprised by the sudden intensity in his voice. but you didn’t flinch, didn’t back down. you met his gaze head-on, your own expression calm but firm. “yes,” you admitted, your voice steady. “i was with jaehyun.”
your brother’s jaw tightened, his fists clenching at his sides. “are you out of your mind?” he snapped, the anger finally spilling over. “do you have any idea who that man is? what he’s accused of?” you held your ground, refusing to let his anger sway you. “he didn’t do it,” you said softly, but there was a conviction in your voice that made your brother pause.
“how do you know?” he demanded, his voice rising with frustration. “how can you be so sure he’s not playing you? that he’s not dangerous?” for the first time, you hesitated, the answer on the tip of your tongue but too complicated to put into words. you couldn’t explain the way you just knew, the way you had looked into jaehyun’s eyes and seen something that no one else seemed to see—something that told you he wasn’t capable of the horrors he was being accused of. but how could you explain that to your brother? how could you make him understand?
your silence spoke volumes, and your brother shook his head in disbelief, his expression a mix of anger and fear. “you’re too trusting,” he said finally, his voice tinged with desperation. “you can’t just believe in everyone. this isn’t some fairy tale where the bad guy turns out to be good in the end. this is real life, and people like him, they don’t change.”
“he’s not who you think he is,” you tried to argue, but your brother cut you off, his frustration boiling over. “stay away from him,” he ordered, his tone leaving no room for argument. “i don’t want you anywhere near him. if you see him again, you call me. do you understand?”
you looked at him, your heart aching at the fear and anger in his eyes. you knew he was only trying to protect you, to keep you safe, but you also knew that he was wrong about jaehyun. but what could you do? you couldn’t fight him on this, not without risking a rift between you. so you nodded, even though every fiber of your being wanted to protest, to argue that jaehyun wasn’t the monster your brother believed him to be. “fine,” you said quietly, your voice tinged with resignation. “i’ll stay away.”
the morning air was thick with the promise of rain as you made your way to the local store. the clouds overhead hung heavy and dark, a stark contrast to the bright resolve in your heart. you had no intention of staying away from jaehyun, no matter what your brother had said. there was something in the way jaehyun looked at you, something in the depth of his eyes that told you he wasn’t what the world believed him to be. your brother’s words echoed in your mind, but they couldn’t drown out the quiet, persistent certainty you felt. so, you went about your day as planned, pretending that nothing had changed, that your brother’s warning wasn’t still ringing in your ears.
the store was quiet when you arrived, the usual hum of life dulled by the oppressive weight of the storm that threatened to break. you wandered the aisles, picking out the things you needed—a few groceries, some toiletries, nothing too out of the ordinary.bBut as you reached for a carton of milk, you couldn’t help but wonder if you should pick up something extra, something you might offer jaehyun should you cross paths with him again. the thought brought a small smile to your lips, a secret shared only with yourself.
your basket filled, you made your way to the register, exchanging pleasantries with the cashier as you paid for your items. the moment you stepped outside, however, you were met with the harsh reality of the storm that had been building all morning. the rain came down in sheets, pounding against the pavement with a ferocity that took you by surprise. you paused just outside the door, bags in hand, as the rain soaked through your clothes almost instantly. you raised an arm to shield your head, but it did little to protect you from the downpour.
you cursed under your breath, glancing around for any cover you could find, but the rain was relentless. it was as if the heavens had opened up, and you were caught in the middle of it with no escape. you shivered, the cold seeping through your clothes, and just as you were about to resign yourself to the wet, uncomfortable walk home, you felt something warm and dry settle over your head.
startled, you looked up, your heart skipping a beat as you found jaehyun crouched beside you, his jacket held above both your heads as a makeshift umbrella. his presence was like a jolt of electricity, unexpected yet oddly comforting. his face was calm, expressionless even, but his actions spoke louder than words ever could. “where did you come from?” you asked, your voice laced with surprise as you stared at him.
he didn’t answer right away, his gaze fixed ahead as he guided you under the shelter of his jacket. “it doesn’t matter,” he finally said, his tone flat, almost detached. “you’re going to catch a cold if you stay out here.” there was something so inherently touching in his words, a care that seemed almost out of place given the stoic expression on his face. his voice was devoid of emotion, but the simple act of shielding you from the rain said more than any words ever could.
a small, amused smile tugged at the corners of your lips despite the rain. “you must feel like a gentleman,” you teased lightly, trying to coax a reaction out of him.
he looked at you then, his dark eyes reflecting the storm around you both. “i think it’s better not to feel,” he replied, his voice as calm and steady as the rain pouring down around you. you couldn’t help but scoff, shaking your head slightly. “yeah, right,” you murmured, though there was no real bite to your words. you knew better than that. he might try to hide it, but you could see the turmoil beneath the surface, the conflict he kept buried deep within.
without another word, jaehyun guided you toward the bus stop, his jacket still held protectively over your head. the rain continued to fall in torrents, but the small shelter of the bus stop provided some relief. you both stepped under it, and jaehyun finally lowered his arm, letting the jacket fall to his side.
“thank you,” you said, your voice soft as you looked up at him. the rain had plastered your hair to your face, and you could feel the cold biting at your skin, but you couldn’t help the warmth that spread through your chest at his gesture. “that was really kind of you.” he shrugged, his expression still guarded. “it’s the least i can do.”
there was a pause, the sound of the rain filling the silence between you. you studied him, noting the way his hair clung to his forehead, the way his clothes were as drenched as yours. and yet, there was a quiet strength in him, a resolve that made you believe he would do this all over again if it meant keeping you safe. “are you headed home?” you asked, breaking the silence. he nodded, his gaze flicking to the side before returning to you. “yeah, but i hope to see you soon.”
something about the way he said it, so simple yet so heavy with unspoken meaning, made your heart flutter in your chest. before you could respond, jaehyun turned to leave, the jacket still clutched in his hand. but instead of taking it with him, he draped it over your shoulders, the warmth of the fabric immediately comforting against your cold, wet skin. you opened your mouth to call after him, to tell him to take it back, but before you could get the words out, he was already gone, disappearing into the rain like a ghost. you stood there for a moment, the jacket draped over your shoulders and the scent of him lingering in the air around you. the rain continued to fall, but it was as if the world had gone still, the only sound the steady rhythm of your heartbeat echoing in your ears.
you pulled the jacket tighter around yourself, a small smile playing on your lips as you turned back toward the bus stop, the weight of his actions settling over you like a warm blanket. despite everything—your brother’s warnings, the suspicions that surrounded him—you knew you couldn’t stay away from him. there was something in him, something that called to you, something that made you want to believe in him. and as you waited for the rain to let up, you knew deep down that this wouldn’t be the last time your paths crossed.
jaehyun’s apartment was a place where silence reigned, a heavy, oppressive silence that seemed to seep into the walls, swallowing any hint of life or warmth. the space was eerily empty, devoid of anything that might give it the feeling of a home. the only light came from a single, bare bulb hanging from the ceiling, casting long, harsh shadows across the room. the walls were bare, painted a dull, lifeless gray that matched the concrete floor beneath his feet. there was no furniture, save for a single chair in the center of the room, where the cries of a man echoed off the walls, growing louder with each passing second.
the man in the chair struggled against his restraints, his hands tied tightly behind his back, his arms bound to the sides of the chair. q towel was wrapped around his face, tucked cruelly into his mouth, muffling his desperate pleas. his eyes were wild with fear, darting around the room, searching for some escape, some way out of this nightmare. but there was none. the only thing he could see was jaehyun, standing in front of him, his expression as cold and emotionless as the room itself.
his eyes were fixed on the man, unblinking, as he crouched down in front of him, bringing himself to eye level. his face was a mask of indifference, betraying no hint of the thoughts that might be running through his mind. he didn’t speak right away, didn’t acknowledge the man’s muffled cries. instead, he simply watched, his gaze steady and unyielding, as if he were looking right through him, into the very core of his being.
the man’s cries grew louder, more frantic, as he realized there was no mercy in those cold eyes staring back at him. he shook his head violently, trying to dislodge the towel from his mouth, trying to make himself heard, to beg for his life. but jaehyun didn’t move, didn’t react. he simply waited, letting the man exhaust himself in his futile struggle, until finally, his movements slowed, his cries turning to quiet, broken sobs.
and then, in a voice that was almost too calm, too measured, jaehyun spoke. “it’s a shame you told your sister to stay away from me.”
your brother’s eyes widened in horror, his muffled cries returning with a renewed intensity as he realized the gravity of those words. he thrashed against his restraints, but there was no escape. jaehyun remained still, his gaze unwavering as he reached into his back pocket, pulling out a small, sleek handgun. the metal glinted ominously in the dim light, and the sound of the gun being loaded echoed through the empty apartment like a death knell.
his expression didn’t change as he continued, his voice eerily calm, almost detached. “all of this could’ve been avoided.”
there was no anger in his tone, no trace of the emotions that might accompany such a statement. it was as if he were commenting on the weather, or discussing something as mundane as the time of day. your brother in the chair could only watch in terror, his cries reaching a fever pitch as jaehyun calmly raised the gun, leveling it at his forehead. the silence that followed was deafening, the weight of it pressing down on the room like a suffocating blanket. and then, without a moment’s hesitation, he pulled the trigger.
the sound of the gunshot was deafening in the small, enclosed space, reverberating off the walls with a violence that shook the very air around them. your brother’s head snapped back, his body going limp as the life was extinguished from his eyes in an instant. blood splattered against the walls, dark and wet, staining the dull gray with a stark, vivid red. the room was still again, the only sound the faint, echoing ring of the gunshot that slowly faded into silence.
jaehyun stood, his movements slow and deliberate, as he tucked the gun back into his pocket. his face remained expressionless, devoid of any hint of what he might be feeling. there was no remorse in his eyes, no regret, only a cold, unfeeling detachment as he looked down at the lifeless body slumped in the chair. for a moment, he simply stood there, staring at the man he had just killed, as if contemplating something, though what, no one could say. and then, without a word, without a second glance, he turned and walked away, leaving the apartment as empty and silent as it had been before. the door closed behind him with a soft click, and the only evidence that he had ever been there at all was the body left in his wake.
the silence in your home was a stark contrast to the tension that had lingered in the air earlier. your brother was gone, his absence marked only by the note he had left on the fridge. you saw it the moment you walked into the kitchen, a small scrap of paper taped to the metal door, the words scrawled in his familiar handwriting: “had to pick up a few more shifts because of the case. don’t wait up.” you read the note twice before crumpling it in your hand and tossing it into the trash. it wasn’t unusual for him to be gone, especially with the weight of the ongoing investigation. you brushed off the small twinge of unease that had settled in your chest and tried to push your thoughts elsewhere.
you spent the next hour lounging around the house, flipping through tv channels, but nothing could hold your attention for long. the rooms felt empty, hollow almost, and the silence that once brought you comfort now only served to remind you of the isolation. you moved from the couch to the kitchen, from the kitchen to the bedroom, restless and bored. eventually, you found yourself standing in front of the mirror, contemplating your reflection. the idea of heading out had been growing steadily in the back of your mind, a distraction from the loneliness that clung to you like a second skin.
you decided to go to the bar. it wasn’t a place you frequented often, but tonight, the thought of being surrounded by people, the hum of conversation, and the dim lights felt like exactly what you needed. you took your time getting ready, not rushing the process. the dress you chose was one that always made you feel confident, a deep, rich color that clung to your figure in all the right ways. it wasn’t overly revealing, but it had a certain elegance to it, a subtle allure that drew the eye. you spent a few extra moments on your makeup, accentuating your features, adding a touch of color to your lips, and just enough liner to make your eyes pop.
as you stood back to admire your reflection, you couldn’t help but smile at how you looked. stunning, even if it was just for yourself. before you left, you grabbed jaehyun’s jacket, the one he had draped over you in the rain. you wrapped it around yourself, the fabric still carrying the faintest scent of him, a mix of something clean and crisp, yet undeniably masculine. it was comforting, in a way that you couldn’t quite place, as if wearing it provided an extra layer of protection.
the bar was dimly lit, the kind of place where people went to forget the outside world for a while. the warm, amber light filtered through the haze of cigarette smoke, casting soft, flickering shadows across the room. the low hum of chatter and the clink of glasses filled the air, blending together into a background noise that was almost soothing. you found a seat at the bar, ordering yourself a drink and settling into the solitude of your thoughts.
the first sip of your drink warmed you from the inside out, easing the tension in your shoulders as you let yourself relax. the bartender was friendly enough, offering you a smile as he set your drink down in front of you, but he didn’t pry, didn’t ask questions. he could probably tell you were here to be alone, to enjoy your own company, and for that, you were grateful.
you sipped your drink slowly, savoring the burn of alcohol as it slid down your throat, your eyes drifting over the scene around you. people moved through the space in pairs or groups, laughter and conversation flowing freely between them, but none of it reached you. you were content in your bubble of solitude, letting the world fade into the background. but then, out of nowhere, you felt it—a presence behind you, the sensation of someone standing too close, invading your space. you stiffened slightly, your hand tightening around your glass as the man leaned in, his breath hot against your ear.
“hey, beautiful,” he drawled, his voice low and smooth, dripping with the kind of false charm that set your teeth on edge. “what’s a pretty thing like you doing here all alone? wouldn’t you rather come home with me?”
you resisted the urge to recoil, instead forcing yourself to stay calm as you replied, “i’m not interested.”
but he didn’t take the hint. his hand grazed your lower back, fingers trailing over the curve of your hip before dropping lower, brushing against your ass with a familiarity that made your skin crawl. “come on,” he murmured, his voice dripping with arrogance, “don’t be like that.”
you were about to turn around and shove him away, your irritation boiling over into anger, when suddenly, his touch was ripped away. there was a blur of motion, and before you could fully register what was happening, the man was on the ground, sprawled out at your feet.
jaehyun was on top of him, his expression a mask of cold fury as his fist slammed into the man’s face, again and again, the sickening crunch of bone meeting bone echoing through the bar. the man’s cries of pain were muffled by the impact, blood splattering across the floor as jaehyun’s blows grew more violent, more relentless.
you were frozen in shock, your mind struggling to process the scene unfolding in front of you. jaehyun’s expression was one of terrifying calm, his movements precise and controlled, but there was something in his eyes, something dark and dangerous that sent a chill down your spine.
“jaehyun, stop,” you finally found your voice, reaching out to grab his arm, trying to pull him off the man. but it was like trying to move a mountain—he was immovable, his focus entirely on the task at hand, the brutal act of violence he was committing with such cold detachment. “jaehyun, please!” you pleaded, your voice trembling as you tugged harder at his arm, desperation creeping into your tone.
it wasn’t until you locked eyes with him, your gaze pleading and terrified, that something in him shifted. the hardness in his expression softened ever so slightly, and he paused, his fist hovering in the air, mid-strike. his chest heaved with exertion, and for a moment, the only sound was the ragged breathing of the man beneath him, his face a bloodied mess. slowly, he lowered his fist, his eyes never leaving yours. the bar had fallen silent, all eyes on the two of you, the tension thick and suffocating. the bartender was already on the phone, calling the police, and you knew you had to get jaehyun out of there before they arrived.
you grabbed his hand, your grip firm as you pulled him to his feet. he didn’t resist, allowing you to lead him out of the bar, the two of you pushing through the crowd of stunned onlookers. the moment you stepped outside, the cool night air hit you, a stark contrast to the suffocating atmosphere inside the bar. you didn’t stop until you were a few blocks away, your heart pounding in your chest, your mind racing with the events that had just unfolded. you finally let go of his hand, turning to face him, your breath coming in short, sharp gasps.
“what were you thinking?” you demanded, your voice trembling with a mix of fear and anger. he didn’t answer right away. his expression was unreadable, but there was something in his eyes, something that told you he wasn’t as unaffected by what had just happened as he appeared to be. he reached out, his fingers brushing against your cheek, his touch surprisingly gentle given the violence you had just witnessed.
“i couldn’t let him hurt you,” he said quietly, his voice void of emotion, but there was something beneath the surface, something raw and vulnerable that he was trying desperately to keep hidden. you wanted to be angry with him, to demand an explanation, but the words caught in your throat. instead, you found yourself nodding, the adrenaline slowly draining from your system, leaving you feeling weak and shaky.
the night air was cool against your skin as you walked alongside him, leading him back to your house. the streetlights cast long shadows across the pavement, and the distant sounds of the city seemed to fade away as the two of you walked in silence. your heart was still racing from the events at the bar, but the tension had begun to ebb away, replaced by a heavy, lingering exhaustion. he walked quietly beside you, his hands tucked into the pockets of his jacket. his face was calm, his expression unreadable, but you could sense the turmoil beneath the surface. the adrenaline of the fight had drained away, leaving behind a man who was clearly grappling with something deeper, something darker.
as the two of you neared your house, you felt a knot of anxiety tighten in your chest. you had been turning over your thoughts since you left the bar, trying to find the right words to say. it wasn’t just about what had happened tonight—it was about everything. about the man standing next to you, and the path he seemed to be walking down.
you slowed your pace, eventually coming to a stop at the corner of the street, just a few houses away from your own. jaehyun stopped too, his gaze shifting to you, his eyes dark and questioning. “i need to tell you something,” you said, your voice soft, almost hesitant. the words were difficult to say, but you knew you had to.
he tilted his head slightly, his eyes narrowing in concern. “what is it?” he asked, his voice low, steady. you took a deep breath, gathering your courage. “you have to stop what you’re doing, jaehyun. you have to change.”
for a moment, there was nothing but silence between you. the street was empty, the night quiet, and you could hear the distant hum of cars in the background. jaehyun’s expression remained neutral, but you could see the flicker of something in his eyes, a shadow of doubt or fear that he was trying to hide. he turned his gaze away, looking off into the distance. “i don’t think I can,” he finally said, his voice barely above a whisper. there was a heaviness to his words, a resignation that weighed down on your heart.
you reached out, gently touching his arm, drawing his attention back to you. “please, jaehyun. try, for me.”
those last words seemed to hit him harder than anything else you had said. his eyes met yours again, and for the first time since you had met him, you saw something soften in his expression. his cold, guarded exterior cracked just enough for you to see the man beneath, the one who had buried himself under layers of violence and detachment.
slowly, almost imperceptibly, a small smile tugged at the corners of his lips. it was faint, barely there, but it was real. “i’ll try,” he said, his voice gentler than before. “for you.”
the relief that washed over you was immediate, a wave of warmth that chased away the lingering anxiety in your chest. you smiled back at him, squeezing his arm lightly before letting go. “thank you,” you whispered, your voice full of emotion. with that, the two of you continued your walk, the distance between your house and the corner where you had stopped feeling much shorter now. when you reached your front door, you unlocked it and stepped inside, the familiar comfort of home greeting you as you crossed the threshold. jaehyun followed, closing the door behind him.
the quiet of your home was a stark contrast to the chaos of the bar. it felt like a sanctuary, a safe haven from the outside world, and as you kicked off your shoes and hung up your jacket, you could feel the tension in your body begin to ease. you glanced over at jaehyun, who stood near the door, his eyes scanning the room as if taking in every detail. there was a subtle shift in his demeanor, a slight relaxation in his posture, though his eyes remained guarded. he watched you as you moved around the house, his gaze following your every step.
“do you wanna watch something?” you asked, trying to break the silence. you didn’t want him to leave just yet, not when there was still so much unspoken between you. he nodded, his expression softening. “sure.”
you walked over to the living room and settled on the couch, grabbing the remote and flipping through the channels until you found something that caught your interest. jaehyun joined you, sitting down beside you, though he kept a respectable distance. the television flickered to life, casting a warm glow across the room. the sound of the show filled the air, but your attention was only half on the screen. you couldn’t help but steal glances at him, noticing the way his eyes occasionally flicked toward you, as if he was trying to understand you, to decipher the thoughts that were running through your mind.
after a while, you got up and went to the kitchen, the idea of cooking something for the both of you suddenly appealing. the act of cooking had always been therapeutic for you, a way to clear your mind and focus on something simple, something tangible. you began gathering ingredients, moving around the kitchen with practiced ease, and you felt Jaehyun’s presence behind you, watching you.
“you don’t have to do that,” he said, his voice soft, almost hesitant. you turned to him, offering a small smile. “i want to. it’s nice to have someone to cook for.”
he didn’t say anything in response, but the look in his eyes spoke volumes. there was something almost vulnerable in his gaze, a quiet appreciation that he didn’t know how to express in words. he watched as you moved around the kitchen, his eyes never leaving you, as if he was trying to memorize every detail of this moment. the two of you fell into a comfortable rhythm, the tension that had once hung between you slowly dissipating. he offered to help, and though he was clumsy in the kitchen, you appreciated the effort. it was a small thing, but it meant more than he could possibly know.
when the food was ready, you brought the plates to the living room, the two of you settling back on the couch to eat. the television continued to play in the background, but neither of you paid much attention to it. the conversation between you was quiet, subdued, but there was a warmth to it that hadn’t been there before. as you finished your meal, you leaned back against the couch, feeling content and at peace. he set his plate aside and turned to you, his gaze lingering on your face. there was something in his eyes, something soft and unguarded, that made your heart skip a beat.
“you’re— different,” he said quietly, his voice almost reverent. you raised an eyebrow, smiling softly. “different how?”
he didn’t answer right away, his eyes searching your face as if trying to find the right words. “gentle,” he finally said, his voice barely above a whisper. “sweet.”
the words were simple, but they carried a weight that made your breath catch. you could see the sincerity in his eyes, the way he looked at you as if you were something precious, something he didn’t quite know how to handle but was afraid of losing. for a moment, neither of you spoke. the silence was heavy, but it wasn’t uncomfortable. it was filled with unspoken words, with the quiet understanding that something had shifted between you. something that neither of you were quite ready to acknowledge, but that you both felt all the same.
you reached out, your hand finding his, and you squeezed it gently. “you don’t have to be different with me, jaehyun,” you said softly. “just be you.” a small smile tugged at his lips, and for the first time, you saw a glimpse of the man he could be—the man he wanted to be, for you.
the night wore on, and as the minutes ticked by, you found yourself slowly succumbing to the warmth of the couch and the soft, comforting murmur of the television. the day’s events had taken their toll, and the quiet, steady presence of jaehyun beside you brought a sense of security you hadn’t realized you were craving. your eyelids grew heavy, each blink becoming slower than the last, until eventually, your head began to tilt to the side. he noticed the subtle shift in your posture, the way your body gradually leaned toward him as sleep claimed you. he stiffened slightly, unsure of what to do. it was new territory for him—uncharted and strange.
he wasn’t used to this kind of closeness, to the softness of another person so near. but as he turned his gaze to you, watching the way your features relaxed into sleep, something inside him shifted. the hardness, the constant alertness that had been ingrained in him for so long, seemed to melt away, leaving behind a quiet, unfamiliar stillness.
you looked so peaceful, so vulnerable. your breathing was slow and steady, your chest rising and falling in a gentle rhythm. your lips were slightly parted, and a few strands of hair had fallen across your face. he stared at you, his eyes tracing the delicate lines of your features—the curve of your cheek, the soft sweep of your lashes, the way your lips curled up just slightly at the corners, as if you were dreaming of something pleasant. for a long moment, he simply watched you, his mind strangely quiet. there was no rush of thoughts, no internal dialogue. just silence. and in that silence, he realized something—he wasn’t just watching you. he was admiring you.
hesitantly, as if testing the waters, he let his hand fall, his fingers hovering just above your skin. he hesitated for a heartbeat, then let his hand drop to your face, his palm brushing against your cheek. the warmth of your skin surprised him, sending a jolt of something foreign through him—something he couldn’t quite name but didn’t want to ignore. his thumb moved of its own accord, tracing the soft curve of your cheekbone. your skin was smooth under his touch, warm and inviting. he didn’t feel the usual surge of aggression that often accompanied physical contact, nor did he feel the emptiness that had become his constant companion. what he felt was something different—something that made his chest tighten and his breath catch in his throat.
his thumb continued its slow, reverent path, moving down to trace the outline of your jaw. the motion was gentle, almost tender, as if he was afraid of waking you or breaking the fragile peace that had settled over the two of you. his gaze lingered on your face, on the soft curve of your lips, the way your lashes fanned out against your skin. he had never really looked at you like this before, never taken the time to truly see you. and now that he was, he couldn’t look away. you were beautiful.
the thought slipped into his mind unbidden, startling him with its intensity. he hadn’t thought much about beauty before—hadn’t allowed himself to. But now, with you asleep beside him, your face relaxed and free of worry, he couldn’t help but think it. you were beautiful in a way that was more than just physical. it was in the way you had looked at him earlier, the way you had asked him to try, for you. It was in the softness of your voice, the gentleness of your touch, the quiet strength that seemed to radiate from you.
he found himself marveling at it, at the way you seemed to make everything else fade away, leaving only this moment, this connection between the two of you. the foreign feeling in his chest grew stronger, spreading through him like a slow-burning fire. it was warm, almost comforting, and for the first time in a long while, he didn’t feel alone. he didn’t feel empty. he felt something.
jaehyun wasn’t sure how long he stayed like that, his hand resting against your cheek, his thumb gently caressing your skin. time seemed to stretch, each second blending into the next, until it felt like the whole world had narrowed down to just the two of you, here on this couch, in this quiet, darkened room. eventually, he felt his own eyelids grow heavy, the day’s events catching up to him as well. but he didn’t want to move, didn’t want to break the connection between you. so he stayed where he was, his hand still resting against your cheek, his body leaning ever so slightly toward yours.
his eyes drifted closed, and he let himself relax, the tension in his shoulders easing as he finally allowed himself to give in to the pull of sleep. the last thing he felt before he drifted off was the warmth of your skin against his palm, and the last thing he saw in his mind’s eye was the peaceful look on your face. and then he was asleep, the two of you side by side on the couch, wrapped in a cocoon of quiet, shared warmth.
the morning light filtered in through the half-drawn curtains, casting a soft, golden glow over the room. you stirred slowly, the warmth beneath you unfamiliar yet comforting. qs your eyes fluttered open, you realized that your head was resting in jaehyun's lap. he was still asleep, his breathing steady and deep, his hand resting lightly against your arm as if even in sleep, he was unconsciously holding onto you.
you blinked a few times, adjusting to the morning light, and looked around. the apartment was still and quiet, almost eerily so. there was no sign of your brother, and you didn’t know whether to feel concerned or relieved by his absence. part of you expected to hear the familiar sounds of him moving around the house, making coffee or getting ready for the day, but there was nothing. just silence.
your thoughts drifted to jaehyun, and as you shifted slightly in his lap, he began to stir. his eyelids fluttered, and then his eyes opened slowly, blinking against the light. for a moment, he seemed disoriented, as if he had forgotten where he was. but then his gaze settled on you, and a softness crept into his eyes that you had never seen before.
“good morning,” you whispered, your voice still heavy with sleep. “morning,” he murmured back, his voice low and husky. there was a brief silence as you both took in the situation, the strange intimacy of waking up like this.
“i’m sorry,” you began, a little flustered, as you started to sit up. “i hope i didn’t make you uncomfortable…” before you could finish, he shook his head, quick and sure. “no, it was great,” he said, his tone almost too earnest. there was a sincerity in his words that made your heart skip a beat.
a small smile tugged at the corners of your lips as you pushed yourself up and off his lap. the cool air of the room made you shiver slightly, but you shook it off as you stretched. “how about i make us some breakfast?” you suggested, eager to fill the quiet with something other than the racing thoughts in your mind. he nodded, watching you closely as you moved about the kitchen. the normalcy of it all felt surreal—cooking breakfast, making coffee, jaehyun quietly observing you from his place on the couch as if it were the most natural thing in the world. but it wasn’t. nothing about this was normal, and yet, you found yourself wanting to make the most of it. to linger in this moment just a little longer.
you focused on the task at hand, cracking eggs into a bowl, whisking them with a practiced ease. as you poured the mixture into the pan, the sizzle of the eggs against the hot surface filled the silence, and you let out a small, contented sigh. “you shouldn’t work so much,” he said suddenly, breaking the silence. his voice was quiet, but there was an edge to it that made you pause.
you glanced over your shoulder at him, your brow furrowing slightly. “i like working,” you replied, turning back to the stove. “besides, it keeps my mind busy.” he didn’t respond immediately, but you could feel his eyes on you, studying you, as if trying to understand something that eluded him. the weight of his gaze was almost palpable, and for a moment, you were hyper-aware of every movement you made.
as you continued to work, you didn’t notice jaehyun slowly rising from the couch. he moved quietly, almost predatorily, his eyes never leaving you. there was a tension in his movements, something raw and primal that made him seem like a hunter stalking his prey. but it wasn’t that simple. he wasn’t looking at you like you were prey—he was looking at you like you were something precious, something delicate that needed to be protected. the comparison didn’t even feel right in his mind. no, it was more like he was drawn to you, like you were a rare, blooming flower amidst a field of withering ones. he felt this overwhelming urge to hold onto you, to shield you from the world before you could fade away.
you felt his presence before you saw him, a subtle shift in the air that made you pause. when you turned, your breath caught in your throat as you found him standing so close, his expression intense, yet vulnerable in a way that left you momentarily speechless. his eyes widened slightly, as if surprised by his own actions, but before he could apologize or step back, you smiled up at him, a soft, understanding smile that seemed to ease the tension in his shoulders.
“i’m sorry,” he murmured, his voice barely above a whisper, his hand half-raised as if unsure whether to reach out to you or not. you shook your head gently, closing the distance between you. “it’s okay,” you whispered back, your voice soothing. your hand came up to rest lightly on his arm, your touch grounding him in a way that nothing else ever had.
the two of you stood there, the air thick with something unspoken, something electric that made your pulse quicken. you stared into each other’s eyes, the rest of the world fading into the background. You could see the conflict in his gaze, the way he was struggling with his emotions, with this unfamiliar territory. and then, without thinking, you leaned in.
it was a small movement, almost imperceptible, but jaehyun noticed. his breath hitched, and for a brief, heart-stopping moment, he hesitated. but then, something inside him snapped, and he closed the distance between you, his lips finding yours in a gentle, hesitant kiss. the kiss was soft at first, almost tentative, as if he was afraid of hurting you, of breaking you. but as you responded, your lips moving against his with a quiet urgency, he began to relax. his hand came up to cup your face, his thumb brushing against your cheek as he deepened the kiss.
you felt a rush of warmth flood your chest, your heart pounding in your ears as you kissed him back, your arms wrapping around his neck to pull him closer. the world fell away, leaving just the two of you, connected in a way that felt both thrilling and terrifying. jaehyun’s other hand found your waist, his grip firm yet gentle as he lifted you with ease, placing you on the kitchen counter. the cool surface against your skin sent a shiver down your spine, but you hardly noticed, too caught up in the feel of his lips against yours, in the way his body fit perfectly against yours.
your legs wrapped around him instinctively, pulling him closer, deeper into the kiss. you could feel the tension in his muscles, the way he was holding himself back, afraid of losing control. but you didn’t want him to hold back. you wanted all of him—his strength, his passion, his intensity. when he finally broke the kiss, both of you were breathing heavily, your foreheads resting against each other as you tried to catch your breath. his hands were still on you, one resting on your waist, the other gently brushing the stray hairs from your face.
he looked at you then, really looked at you, and for the first time, you saw something in his eyes that made your heart skip a beat. it was vulnerability, raw and unguarded, as if he was letting you see a part of him that no one else had ever seen. and then, without another word, he kissed you again.
this time, the kiss was more intense, more urgent, as if he was pouring all of his emotions into it. his hands roamed your body, exploring, memorizing every curve, every dip of your skin. you could feel his heart pounding against yours, could feel the way his breath hitched every time you moved. you lost yourself in the kiss, in the feel of him, in the way he made you feel. there was nothing else—no worries, no fears, just the two of you, here in this moment, wrapped up in each other. and for the first time in a long while, you felt safe.
you pulled back slightly, gasping for air, your eyes searching his. “i want you,” you whispered, your voice hoarse with desire. jaehyun’s eyes darkened, his pupils dilating with need. he didn’t say anything, but the way he looked at you spoke volumes. you reached for the hem of his shirt, pulling it up and over his head, revealing the chiseled muscles that lay beneath. your hands roamed over his bare chest, feeling the heat of his skin, the beat of his heart beneath your fingertips.
he stepped closer, his hands sliding under your shirt, his touch sending waves of pleasure through your body. you moaned softly, arching into him as he kissed along your neck, his teeth grazing your skin just hard enough to leave a trail of goosebumps in their wake. you felt his hands unbutton your pants, his fingers deftly unhooking your bra, and a thrill shot through you. this was happening. you were really doing this with him, and it felt right.
his mouth found yours again, his tongue dancing with yours as he pushed your pants down your legs. you stepped out of them, your bare feet brushing against the cold kitchen tiles. he lifted you back onto the counter, his hands supporting your weight as he stepped between your legs. the heat of his body was intoxicating, making you want to melt into him, to never let go.
and then, with one simple movement, he entered you, filling you completely. you gasped, your nails digging into his back as the sensation overwhelmed you. it was unlike anything you’d ever felt before—so raw, so intense, so real. jaehyun’s eyes never left yours, his expression a mix of pleasure and something else—something deeper, something that made your heart ache.
you moved together, finding a rhythm that felt like it had been written just for the two of you. your bodies were one, moving in perfect harmony, as if they had been made to fit together. there was nothing but the sound of your ragged breaths, the slap of skin against skin, and the quiet moans that slipped from your lips. jaehyun’s movements grew more urgent, his grip on your hips tightening as he pushed deeper, harder.
you could feel yourself getting closer, the pressure building, your body tightening around him. “yes,” you moaned, your voice needy. “just like that, jaehyun. don’t stop.” he didn’t. he didn’t stop, didn’t hold back, giving you everything you’d ever wanted from him, everything you hadn’t even known you needed. and when you finally came, it was with his name on your lips, his eyes staring into yours, as if he could see straight into your soul. his own release followed shortly after, his body tensing, his eyes squeezing shut as he buried his face in your neck. you held onto him, feeling his warmth, his breath against your skin. for a moment, you just stayed like that, your bodies still connected, your hearts beating in sync.
once the tremors had subsided, he pulled back, his eyes searching yours. there was something in his gaze that was almost apologetic, but you knew it wasn’t for what just happened. it was for everything else—for all the times he’d held back, for all the things he hadn’t said. but in this moment, you didn’t need words. the connection you shared was more than enough.
you leaned in, pressing a gentle kiss to his forehead, feeling the tension in his body ease. “it’s okay,” you murmured, stroking his hair. “i’m here. i’m not going anywhere.” and in that moment, despite his fears, despite the darkness that lurked beneath the surface, jaehyun allowed himself to believe you. because in your arms, he felt like he could finally let go.
the two of you wandered aimlessly through the quiet streets, the afterglow of your shared moment still clinging to the air between you. it was as if time had slowed down, allowing you to savor the warmth that lingered in your chest, the memory of his touch, his kiss, still fresh on your lips. he walked beside you, his steps measured, his gaze forward, yet you could sense the internal battle raging within him. his mind, always calculating, always detached, now struggled to reconcile this newfound vulnerability. he had spent so long keeping everyone at arm’s length, viewing the world through a lens of detachment and apathy. but with you, something was different. you made him feel, and that was both terrifying and exhilarating.
as you walked together, the scenery began to shift. the neighborhood around you changed, becoming less pristine, more worn. the buildings were old, some with peeling paint, others with broken windows patched haphazardly with plastic. the streets were littered with debris, and the once-vibrant graffiti that adorned the walls had faded into dull smudges of color. it was a stark contrast to the warmth you had just shared, and it made you pause.
“do you really live around here?” you asked softly, your voice tinged with concern as you took in your surroundings. he nodded, his jaw clenched as he continued to walk. there was a tension in his posture, a stiffness that hadn’t been there before. he was used to this environment, to the bleakness and the harshness of it, but he wasn’t used to sharing it with someone like you. he wasn’t used to someone seeing this part of his life, this part of him.
you watched him, noting the way his shoulders seemed to draw inwards, as if he were trying to shield himself from your gaze. without thinking, you reached out and took his hand in yours, lacing your fingers together in a simple, yet deliberate act of comfort. the gesture made him falter, his steps slowing as he looked down at your joined hands, surprise flashing in his eyes.
“you should come over to my place more often,” you said softly, offering him a smile that was both gentle and reassuring. “you don’t have to stay here if you don’t want to.”
he stared at you, as if trying to comprehend why you would offer something like that, why you would want him around more, especially after seeing where he lived. but instead of questioning it, he found himself nodding, the words of agreement slipping past his lips before he could overthink them. “i’d like that.”
you both walked in silence for a while longer, your hands still entwined, the weight of the world seemingly lighter with him beside you. eventually, you found yourselves at one of the old buildings, a towering structure with crumbling bricks and rusted fire escapes. jaehyun led you up the narrow stairwell, your footsteps echoing in the confined space, until you reached the rooftop.
the view from up here wasn’t the kind you’d typically associate with beauty. the streets below were cracked and dirty, the buildings surrounding you worn and decaying, the air heavy with the scent of pollution. but with jaehyun beside you, it didn’t matter. the two of you stood at the edge, looking out at the cityscape, the sun slowly sinking behind the horizon, painting the sky in hues of pink and orange.
he reached into his pocket and pulled out a joint, sparking it up with the ease of someone who had done it countless times before. he took a slow drag, the smoke curling around his lips before he offered it to you, a glint of something playful in his eyes. you raised an eyebrow, hesitant. you had never been one to indulge in substances like this, and the thought of him relying on them made you uneasy. but you could see the challenge in his gaze, the unspoken dare. he was testing you, trying to see how far you would go for him, if you were willing to step into his world, even if just for a moment.
with a small sigh, you took the joint from his hand, surprising him. “you promised me you’d try to be better,” you said quietly, your eyes meeting his. “i can try for you too.”
he blinked, clearly taken aback by your words, by the way you seemed so willing to step out of your comfort zone just for him. there was something about the way you said it, something so sincere, that it shook him to his core. he watched, almost in disbelief, as you brought the joint to your lips and inhaled. the smoke burned your lungs, and you coughed, but you tried again, this time more carefully, letting the warmth spread through your chest.
his heart skipped a beat as he saw you struggle to relax, trying to embrace something foreign to you, all for his sake. he had never expected this. never expected anyone to believe in him the way you did.
“i’m serious,” he said after a moment, his voice low, almost reverent. “about being better for you.” you exhaled slowly, the smoke leaving your lungs as you looked at him, your eyes soft and full of trust. “i know,” you whispered, and when he asked how you could be so sure, you simply smiled.
“i believe in you,” you replied, and those simple words made his heart flutter in a way he had never experienced before. it was a strange sensation, almost alien to him. he had spent so long feeling nothing, so long numbing himself to the world, and yet here you were, making him feel again.
the two of you passed the joint back and forth, the world around you beginning to blur and soften. the harsh edges of reality dulled, replaced by a warm haze that made everything feel distant, dreamlike. you were faded. the tension that had once been so present between you now melted away, replaced by a deep, shared connection that pulsed between you like a living thing. your limbs felt heavy, your thoughts slow and languid, but you didn’t mind. not when you were leaning against his shoulder, the weight of his arm around you, the warmth of his body grounding you. the world below might have been crumbling, but up here, with him, you felt safe.
jaehyun, too, felt something he hadn’t felt in a long time. love, or something close to it, something that made his heart swell and his mind quiet. he had always been a predator in his own world, moving through life with a cold detachment, taking what he wanted without care for the consequences. but with you, it was different. with you, he felt like he had found something worth protecting, something worth holding onto.
he glanced down at you, your head resting against his shoulder, your eyes half-lidded with the haze of the high. you looked peaceful, content, and it made something inside him soften. he wasn’t used to this, wasn’t used to feeling so tender, so vulnerable. but he didn’t hate it. not with you.
“thank you,” he murmured, his voice low and sincere, though he wasn’t sure if you heard him. maybe it didn’t matter. maybe you already knew. the two of you sat there in comfortable silence, the city below forgotten, the worries of the world slipping away. and as the sky darkened, the stars slowly appearing above, you both drifted into a quiet, shared peace, content to simply be in each other’s presence.
the days that followed your shared moment on that rooftop were different for jaehyun. the world seemed clearer, sharper, as if a fog had lifted, revealing all that he had been missing. his mind, usually so cold and calculating, now buzzed with an energy he hadn't felt in a long time. it was an unfamiliar sensation, but not an unwelcome one.
he didn’t want to die. not anymore. not when he finally had something—someone—worth living for. the darkness that had clung to him for so long, the apathy that had guided his every move, began to recede. the idea of losing himself to that darkness, of losing you in the process, terrified him more than anything.
for the first time in his life, he found himself actively avoiding the situations that once drew him in like a moth to a flame. he no longer sought out the chaos, no longer indulged in the reckless behaviors that had defined him for so long. the streets that once called to him with their promises of violence and danger now seemed empty, devoid of meaning. he didn’t want to get caught up in any more bad situations. he didn’t want to risk losing you. instead, he spent his days with a newfound purpose, a resolve to be better, to be someone you could trust, someone you could love. he found himself thinking of you constantly, your voice, your smile, the way you made him feel alive in a way he had never known before. every thought of you strengthened his resolve, reminding him of what was at stake. but the shadows of his past were not so easily escaped.
as the sun dipped below the horizon, casting long shadows across the city, jaehyun found himself alone, standing in an empty alleyway. the air was heavy with the scent of asphalt and exhaust, the quiet hum of the city in the distance. he sparked a cigarette, the familiar burn of nicotine filling his lungs as he leaned against the brick wall, lost in thought.
the sound of footsteps echoed in the alley, and he tensed, his senses sharpening. a woman’s voice cut through the silence, cold and commanding. “i know what you did.”
he turned slowly, his expression calm, controlled, as if her words hadn’t fazed him. the woman stood at the mouth of the alley, her uniform crisp, her badge glinting in the fading light. her gaze was steady, unyielding, as she looked at him with a mixture of disdain and certainty. he took another drag of his cigarette, letting the smoke curl around him as he met her gaze. “i don’t know what you’re talking about.”
she scoffed, her lips curling into a mirthless smile. “oh, i think you do. you killed him.”
his heart skipped a beat, but his face remained impassive, betraying nothing. his mind raced, analyzing, calculating his next move. he could feel the familiar pull of violence, the urge to silence her before she could say anything more. it would be so easy, so quick. but then he thought of you, of the promise he had made, and the darkness inside him hesitated.
“i don’t know what you’re talking about,” he repeated, his voice steady, almost bored.
the officer’s smile widened, her eyes gleaming with a twisted satisfaction. “it’s a shame. i wonder what your girlfriend would say if she knew you killed her brother.”
her words hit him like a sledgehammer, but he didn’t let it show. the cigarette burned between his fingers, but he didn’t move. the urge to attack her, to end this threat to his new life, surged within him, his muscles tensing, ready to spring. he could see it in his mind’s eye—grabbing her by the throat, the life draining from her eyes as she gasped for air. he could feel the adrenaline, the rush that came with the kill.
but then he saw your face, the way you had looked at him, the trust in your eyes. the thought of you finding out, of seeing the darkness in him, made his heart ache in a way he wasn’t used to. he couldn’t do it. mot because he was afraid of the consequences, but because he had promised you. he had promised to be better. so, he did something he had never done before. he walked away.
he dropped the cigarette, crushing it under his heel as he turned his back on the officer, on the temptation to give in to the darkness. every step he took away from her was a victory, a defiance of the person he used to be. the officer’s voice echoed in the alley, taunting, trying to goad him into a reaction. but he didn’t stop. for the first time in his life, he walked away from a fight, from the violence that had always defined him. and as he walked, he felt a strange sense of relief, a lightness that he hadn’t known he was capable of feeling.
he didn’t look back. he didn’t need to. he had made his choice, and it was a choice for you, for the life he wanted to build with you. the darkness would always be a part of him, lurking in the shadows, waiting for a moment of weakness. but for now, he was stronger. for now, he had something worth fighting for, something worth living for. and he wasn’t going to let anyone take that away from him. not even himself.
the days without your brother's presence felt like an eternity. every hour that passed was heavier than the last, each second a weight pressing down on your chest. the apartment, once filled with the sounds of his laughter, his footsteps, his voice, now felt eerily silent, as if the walls themselves were mourning his absence. you tried to carry on as if nothing was wrong, telling yourself that he was just busy, that he would walk through the door any moment, but deep down, you knew something was terribly, terribly wrong.
anxiety gnawed at you, a relentless, gnawing ache that twisted your stomach into knots. the pit in your stomach only deepened with each passing day. sleep was no longer a comfort but a battlefield where your worst fears came to life. you couldn't eat, couldn't focus, your mind constantly replaying the last time you saw him, wondering if you missed some sign, some warning that this would happen.
you tried to keep it together, to stay strong, but the fear was overwhelming. it was like a storm inside you, building in intensity until you felt like you might break apart. you needed someone, anyone, to tell you that everything would be okay, even if it was a lie. you needed comfort, a lifeline, something to anchor you before you were swept away by the tidal wave of grief and fear.
without thinking, your fingers found your phone, dialing a number that had become all too familiar. the ringing in your ear was a small lifeline, a thread connecting you to the one person who had come to mean so much to you in such a short time. the moment you heard jaehyun's voice on the other end of the line, calm and steady, you felt the dam inside you break.
“is something wrong?” he asked immediately, his voice tinged with a concern that was still new to him, still unfamiliar.
you tried to speak, but the words caught in your throat, choked by the sobs that you had been holding back for days. when you finally managed to get the words out, they were broken, fragmented, spilling out in a rush of desperation and fear. “something's wrong, jaehyun. i haven't seen my brother for days. he hasn't called, hasn't texted. i just know something’s happened, i can feel it.”
on the other end of the line, jaehyun was silent, but the sound of your cries cut through him like a blade. this grief, this sorrow that was not his own, was foreign to him, a bitter poison that seeped into his veins, paralyzing him with its weight. he was used to dealing with pain in others, usually inflicted by his own hand, but this, this was different. it was raw, unfiltered, and it made something inside him recoil, as if the grief itself was a living thing, clawing at his insides.
he wanted to make it stop, to ease your pain, but he didn’t know how. his mind raced, searching for the right words, the right thing to say, but all he could think of was the emptiness, the coldness that had always been his companion. he didn’t know how to comfort, didn’t know how to soothe. all he knew was that he couldn’t stand hearing you like this, couldn’t stand the thought of you suffering.
“he’s probably just busy,” he said, his voice softer than it had ever been. “you know how it is with work, sometimes it just takes over. I’m sure he’s fine. he’ll be back soon, and everything will be okay.”
he didn’t believe the words himself, but he needed you to believe them. he needed you to find some peace, some solace in the chaos that was tearing you apart. as he spoke, he could hear your breathing start to calm, your sobs quieting as his words wrapped around you like a fragile, protective shield.
“thank you, jaehyun,” you whispered, your voice trembling but filled with a small, fragile hope. “thank you for being there for me.” he felt something tighten in his chest, a sensation he didn’t recognize, a mixture of relief and something darker, something more dangerous. grief, foreign and unwelcome, twisted inside him, but it wasn’t the grief he felt for your brother, it was something else entirely. it was grief for you, for the pain you were in, for the vulnerability in your voice that made him want to protect you, to shield you from everything that could hurt you.
but grief was not something he was familiar with, not something he knew how to control. it festered inside him, turning, twisting, until it morphed into something more familiar—anger. his fingers tightened around the phone as he ended the call, his jaw clenching as the unwanted emotions surged through him, overwhelming his usual calm.
the aggression that had always been his default response, the darkness that had always been his shield, rose up inside him, demanding release. he stood abruptly, the chair in his room toppling over as he kicked it, the loud crash echoing in the small space. it wasn’t enough. the rage that had been born of grief and fear was a fire that demanded more destruction, more violence, but he fought it back, swallowing it down as he stood there, panting, his hands clenched into fists. but for all the rage that burned inside him, one thing was clear: he couldn’t let it consume him. not now. not when you needed him. he had to be strong, had to be better, for you. the darkness was still there, lurking just beneath the surface, but for now, he forced it down, buried it deep where it couldn’t touch you, where it couldn’t hurt you. for now, all he wanted was to be the person you needed him to be. and for the first time, that thought, that desire, was stronger than the darkness that had always defined him.
the weight of grief sat heavy on jaehyun’s chest, an unfamiliar sensation that gnawed at the edges of his sanity. he wasn’t used to this kind of emotional turmoil, this festering darkness that seemed to grow with each passing hour. the sorrow he felt wasn’t even his own—it was yours. but it had seeped into him, taken root, and now it was twisting into something he could hardly control.
he had tried to push it down, to bury it beneath layers of cold detachment, but it clawed its way back up, demanding to be felt, to be acknowledged. the grief wasn’t something he knew how to deal with, and so it quickly turned into anger. raw, burning anger that made his blood boil and his hands tremble. anger at your brother for dying, anger at himself for killing him, and anger at the world for making him feel so helpless.
he paced the small confines of his apartment, the walls closing in on him as his thoughts raced, each one darker than the last. his mind replayed your voice, the way it had broken over the phone, and it only fueled the fire inside him. he clenched his fists, trying to focus on anything else, anything that would take the edge off the searing rage that threatened to consume him.
just as he felt like he was about to lose control, a sharp knock on the door echoed through the room, cutting through the silence like a blade. his breath hitched, and he stopped in his tracks, his entire body tensing as the knock came again, louder, more insistent. he knew who it was even before he opened the door, a cold dread settling in his gut.
when he swung the door open, there she was—the police officer from before, her cold, piercing gaze locking onto his the moment the door creaked open. her presence was a reminder of the reality he was trying so hard to ignore, a reminder of the violence that simmered just beneath his skin.
“jaehyun,” she greeted, her voice dripping with the same disdain she had shown before. “i told you, i know what you did.”
his jaw tightened, and he forced himself to remain calm, to keep his emotions in check. he met her gaze with a cold, unreadable expression, trying to play it off like her words didn’t affect him, like he didn’t care about the accusations she was hurling his way. “i don’t know what you’re talking about,” he said, his voice flat, devoid of emotion. but even as he spoke, his mind was racing, trying to figure out how to get rid of her, how to make her go away before the anger boiling inside him erupted.
she scoffed, taking a step into the room, her eyes narrowing as she looked him up and down. “don’t play dumb with me. i know you killed him. and it’s only a matter of time before the truth comes out.” the anger flared again, hot and uncontrollable, and he had to dig his nails into his palms to stop himself from lashing out. he could feel the darkness rising inside him, the need to silence her, to make her stop talking, stop threatening the life he was trying so hard to protect.
“it’s a shame,” she continued, her voice taunting, as if she could sense his inner turmoil and was reveling in it. “i really do wonder what your girlfriend will say when she finds out.”
her words hit him like a punch to the gut, knocking the air out of his lungs. the mention of you, of your connection to this, was like a match to gasoline, igniting the fury inside him to a level he had never experienced before. it wasn’t just anger anymore—it was pure, unadulterated rage, and it was directed at the woman standing in front of him. he wanted to strike out, to hurt her, to make her pay for the pain she was causing, but he hesitated. your voice, soft and pleading, echoed in his mind, a reminder of the promise he had made to you. he had promised to be better, to control himself, for you. but the rage was too much, too powerful, and he didn’t know how to stop it.
before he could think, before he could rationalize, he reached for the gun he had hidden away, the cold metal heavy in his hand. his movements were automatic, driven by instinct, by the need to protect what was his. the officer’s eyes widened in shock as she saw the weapon, but she didn’t have time to react. his finger squeezed the trigger, and the deafening sound of the gunshot echoed through the small apartment, shattering the silence.
she crumpled to the floor, the life leaving her eyes in an instant. the sight of her lifeless body, blood pooling around her, hit him like a tidal wave, washing away the anger and leaving only cold, stark reality in its wake. he stared at her, his breath coming in shallow, panicked gasps, as the full weight of what he had done crashed down on him.
the gun slipped from his hand, clattering to the floor as he stumbled back, his heart pounding in his chest. this wasn’t supposed to happen. he wasn’t supposed to lose control like this, not when he had promised you that he would be better. but it was too late now—what was done was done, and there was no going back.
panic surged through him, a cold, paralyzing fear that gripped him by the throat. he couldn’t think, couldn’t breathe, all he could see was the blood, the lifeless body that lay at his feet. and all he could think about was you, and how this would destroy you. his trembling hands fumbled for his phone, and he dialed your number with shaky fingers, his heart racing as he waited for you to pick up. when your voice came through the line, soft and filled with concern, it was like a lifeline, pulling him back from the brink of complete despair.
“jaehyun?” you asked, your voice gentle but tinged with worry. “what’s wrong?” he couldn’t find the words at first, his throat tightening with a mix of fear and guilt. when he finally spoke, his voice was hoarse, filled with a desperation he couldn’t hide.
“i made a mistake,” he choked out, his breath coming in ragged gasps. “i didn’t mean to.”
your alarmed silence on the other end only heightened his panic, and he could hear you moving, the sound of rustling as you hurried to get ready. “i’m coming over,” you said quickly, your voice filled with determination. “i’ll be there as soon as i can. just hold on, jaehyun. i’m on my way.”
as the line went dead, jaehyun stared down at the body on his floor, the reality of what he had done crashing down on him with relentless force. he knew there was no escaping this, no undoing what had been done. the darkness he had tried so hard to keep at bay had finally won, and now he was left to face the consequences. but all he could think about was you, and the look in your eyes when you found out what he had done. the guilt, the shame, and the fear were almost too much to bear, but he had to hold on. he had to see you one last time, even if it meant facing the truth of what he had become.
the frantic pounding of your heart echoed in your ears as you burst into jaehyun’s apartment, breathless and disheveled. the sight that greeted you was a horrific tableau of chaos and blood—a scene straight out of your worst nightmares. the lifeless body of the police officer lay sprawled on the floor, a pool of crimson spreading beneath her. the air was thick with the metallic scent of blood, mingling with the acrid tang of gunpowder.
you froze for a moment, the reality of the scene crashing down on you like a tidal wave. jaehyun stood in the center of the room, his face a mask of anguish and disbelief. his eyes were wild, darting from you to the body on the floor, his breaths coming in ragged gasps. “jaehyun,” you whispered, the word barely escaping your lips. the sheer horror of the scene gripped you, tightening around your chest like a vice. tears sprang to your eyes, but you forced them back, focusing on the man you had come to care for.
he stumbled towards you, his hands reaching out as if to grasp at some semblance of control. “i’m so sorry,” he choked out, his voice breaking. “i didn’t mean to—” before he could finish, you raised a hand, shaking your head with a numb acceptance. “it’s okay,” you said softly, though your voice was strained. “i knew you couldn’t change immediately.”
the words seemed to hit him like a physical blow. his eyes widened, disbelief etched into every line of his face. he looked as though he was teetering on the edge of a precipice, struggling to hold on to whatever shreds of composure he had left.
“please,” he pleaded, desperation flooding his voice. “get angry at me. yell at me. hit me. do something—”
you shook your head, your expression remaining resolute and eerily calm. in the midst of the chaos and the gore, you stood before him, the emotional turmoil contained within you like a storm waiting to break. he looked at you, his gaze searching for some sign of the anger or reproach he so desperately wanted from you. but your face remained a blank canvas, betraying nothing of the inner storm.
finally, he broke, his voice a strained whisper. “i killed your brother.”
the words hung heavy in the air between you, their impact undeniable. for a moment, time seemed to stand still. the intensity of the admission, combined with the grotesque reality of the scene, threatened to overwhelm you.
you took a deep breath, meeting his eyes with a steady gaze. “i know.”
the utter shock on his face was almost palpable. he stared at you, his mouth opening and closing as if he were trying to comprehend the depth of your reaction—or lack thereof. the warmth that had once graced your features had vanished, replaced by a stoic mask of acceptance.
“why?” jaehyun asked, his voice barely more than a whisper. “why would you love me and stay with me if you knew everything?” the question was raw, an unspoken plea for understanding that cut to the heart of his own struggle. you took a step closer, your eyes softening as you looked at him.
“because i believe in you,” you said quietly. “i knew you were trying. i knew that change takes time, and that sometimes, sometimes we falter.” the shock in his eyes deepened, his face a canvas of confusion and disbelief. the realization that you had accepted him despite everything, despite the monstrous act he had committed, was almost too much for him to process.
he swallowed hard, the weight of his guilt and remorse pressing down on him with suffocating force. “i’m so sorry,” he repeated, his voice breaking with raw emotion. without another word, you stepped forward and wrapped your arms around him. the contact was gentle but firm, a silent promise that despite the horror and the pain, you were still there for him. you could feel him trembling against you, the strong, powerful man reduced to a fragile shell of his former self.
“it’ll all be okay,” you murmured into his ear, your voice filled with quiet conviction. he wanted to live, for the first time in forever. you wanted to live. you wanted to live alongside him, it was all you wanted. you wanted to live.
jaehyun clung to you, his breaths coming in shuddering gasps. the reality of what he had done seemed to sink in fully now, and he was left with nothing but the crushing weight of his actions and the glimmer of hope that you represented. as you held him, the enormity of the situation began to settle, the darkness that had enveloped him slowly giving way to the fragile light of your presence.
the room was filled with an oppressive silence, the heavy weight of the aftermath pressing down on both of you. as you slowly pulled away from jaehyun, his eyes locked onto yours, full of a mix of desperation and confusion. but your attention was drawn to the sound of hurried footsteps on the stairs. the tension in the air thickened as an officer burst into view, gun drawn, her expression grim and unyielding.
your heart pounded in your chest, a cold rush of fear gripping you. jaehyun’s gaze followed yours, and for a moment, his eyes widened with understanding, but it was already too late. without thinking, you stepped in front of him, your back facing the officer. the metallic clink of the gun being aimed, the sharp inhale of breath—it all happened in a blur.
time seemed to stretch as you felt a searing pain erupt in your chest, the bullet tearing through your body with a sickening impact. the pain was intense but fleeting, a sharp, fiery stab that left you gasping for breath. the world around you dimmed, a curtain of darkness falling over your vision as you staggered forward. jaehyun’s face contorted in horror and disbelief as he saw you fall, his body moving with a frantic, desperate energy. “no,” he managed to speak, but the sound was swallowed by the cacophony of the moment.
before you could fully collapse to the floor, the officer's gun fired again, the bullet striking jaehyun. he crumpled to the ground beside you, the force of the impact causing him to drop like a ragdoll. the room seemed to close in on itself, the world narrowing to the pain and the two of you lying together on the cold, unforgiving floor.
the silence that followed was filled with the weight of unspoken words and unfulfilled promises. your breaths came in shallow, ragged gasps, each one more difficult than the last. jaehyun's eyes, once so full of anger and torment, were now filled with an aching sorrow as he stared at you. his tears began to fall, mingling with the blood that stained the floor around you.
with trembling hands, you reached out to him, your fingers brushing against his cheek. his face was a mixture of agony and tenderness as he leaned into your touch, placing his cheek against your hand. the world around you continued to blur and fade, the edges of reality dissolving into darkness.
“i love you,” you managed to whisper, the words escaping your lips with a fragile strength.
jaehyun’s tears fell freely now, his entire being shuddering with the depth of his emotion. “i love you too,” he croaked, his voice cracking with the weight of the confession.
in those final, fleeting moments, the world seemed to dissolve into a haze of shadows and fading light. the pain, the fear, the anguish—all of it began to slip away, replaced by a deep, comforting warmth as you clung to the last remnants of consciousness. jaehyun's presence beside you was a bittersweet comfort, a connection that transcended the immediate horrors of the situation.
as your vision dimmed and the darkness began to consume you, you felt a final, overwhelming sense of peace. the last thing you saw was jaehyun’s tear-streaked face, and the last thing you heard was his whispered confession of love, a promise that would linger even as the world faded away.
✧.*
a/n: goodbye this made me so sad
nct jaehyun with big tit reader pls…
JEONG JAEHYUN (정재현) — TWISTED (18+)
✧
the apartment was quiet, save for the gentle hum of the air conditioning and the rhythmic sweep of the mop across the floor. you moved with practiced precision, your hands gliding over every surface with meticulous care. a flick of your wrist here, a light dusting there—small adjustments that hardly seemed worth noting, but they were. every movement had a purpose, even if it was hidden beneath the veneer of tidying up.
the soft afternoon light filtered through the curtains, casting a warm glow over the room. you wiped down the windowsill, straightened the framed photo of you and jaehyun on the shelf with a smug glint in your eyes, and smoothed out the creases in the bedsheets. the apartment, as always, was immaculate, the kind of clean that only came from constant upkeep. but today, the cleaning wasn’t really about cleanliness. it was about preparation.
you paused by the desk, fingers brushing over the cool surface. between the neatly arranged pencil holders and stacks of paperwork, you slipped in a small camera, positioning it just right. a subtle angle, nothing too obvious, but enough to capture every corner of the room. a second camera followed, this one hidden in the far corner, tucked away in the shadows where it wouldn’t be noticed. satisfied, you moved on.
under the bed, you placed a voice recorder, pressing it firmly against the wood, ensuring it was out of sight. there was no room for mistakes, not today. finally, a tiny bug nestled into the corner of the room, blending seamlessly with the décor. you stepped back to admire your work, a slight smile tugging at the corners of your lips. everything was in place.
with a slow, deliberate movement, you tightened the belt around your dress, the soft leather pulling snug against your waist. the fabric draped perfectly, as it always did, every detail considered, every piece of you in control. you reached for the bottle of perfume on the vanity, its familiar scent filling the air as you dabbed it on your wrists. not your favorite scent—his. the one that made him lean in just a little closer, his breath catching for just a second longer.
you adjusted the microphone headset over your ears, the cool metal brushing against your skin. a sip of wine followed, the rich, dark liquid swirling in the glass before you took a slow, savoring taste. the tension in your muscles melted away, replaced by something else, something darker. not stress, not weariness, not betrayal. no, none of those things. what filled you now was a quiet thrill, a heat that coiled low in your stomach, simmering beneath the surface.
without a second glance, you made your way downstairs, the soft click of your heels echoing in the hallway. the receptionist barely looked up as you approached, her hand sliding instinctively to the desk drawer. you slipped her a bundle of cash—thick, well-prepared, without a word exchanged. she nodded, her hand moving to unlock the door behind her. you stepped inside the dimly lit security room, the soft hum of the monitors filling the space around you.
you settled into the chair, your fingers tracing the edge of the wine glass as you watched the screens flicker to life. one by one, the angles of the apartment room came into view, each camera displaying its silent feed. and there he was, as you knew he would be. jaehyun, standing in the corner, his body pressed against someone else. a woman, her legs wrapped around his waist, her arms clinging to his back. their lips moved in a frantic, fevered kiss, bodies entwined as if the world outside ceased to exist.
your eyes lingered on the screen, a slow, satisfied smile creeping across your face as you sipped your wine. typical. the scent of your perfume must have hit him, because his movements stilled for just a moment, nostrils flaring as he pulled back from the kiss. but it didn’t matter. even now, with another woman in his arms, your presence haunted him. and that, more than anything, sent a wave of satisfaction through you.
he pressed her harder against the wall, his fingers tangling in her hair, lips grazing her neck. but you didn’t flinch. you didn’t feel the sting of jealousy, didn’t feel your heart shatter at the sight. instead, there was a sick, twisted pleasure in watching him repeat the same motions he did with you. It should have hurt—should have torn you apart—but it didn’t. if anything, it thrilled you.
there was something captivating in watching his desire, watching him pour himself into someone else, knowing full well that no matter how much he took from her, it would never compare to what you gave. he could try, he could chase that feeling, but it would never be the same. not without you. so you let him have his time. let him indulge. and as you sipped your wine, watching the scene unfold before you, you knew that he would always come back. because no one else would ever match what you had.
the security room was dim, the glow of the monitors casting an eerie light over jaehyun’s sharp features. he sat in the worn leather chair, eyes glued to the flickering screens before him. the scent hit him first, thick and sweet like spun sugar, relentless in its sweetness, clinging to every breath he took. your perfume. it was unmistakable, coating the air with a syrupy heaviness that curled around him like a possessive hand. he grunted softly, his fingers gripping the arms of the chair, knuckles whitening as he inhaled deeply, letting the scent overwhelm his senses.
he knew it too well. the fragrance that lingered on your skin after a night out, the same one that would pull him toward you, that made his breath hitch when he buried his face in your neck. but tonight, the thought gnawed at him. was it for him? the way it used to be? or for your lover, the one you disappeared with after slipping out of the apartment when you thought he wasn’t looking?
the lines blurred in his mind, the sharpness between you and him, between you and whoever else had stolen your time, stolen what should have been his. his jaw tightened as he leaned closer to the screen, eyes narrowing. you had set this up. he knew it the moment he stepped into the room, knew it from the way the cameras were positioned. it was so you—calculated, precise, cruel in a way only he could appreciate. he wanted to hate it, to hate you, but instead, a twisted admiration crawled up his spine. this was your game, and he was only too willing to play.
his eyes roamed over the grainy image as you finally appeared on the screen, your figure unmistakable even through the static. you stepped into view, your dress clinging to your body like it was made for you, and jaehyun’s breath hitched again, the scent of your perfume still assaulting his senses. his hand, almost unconsciously, moved to his lap, the tension in his body easing slightly as he spread his legs wider, trying to alleviate the growing ache. but you weren’t alone.
his teeth grazed his bottom lip as he watched, every muscle in his body going rigid as a man stepped into the frame behind you. tall, unfamiliar, hands that gripped you too familiarly, lips that ghosted over the curve of your neck with an urgency that made jaehyun’s skin prickle. the man’s mouth moved against your skin, bruising and licking, leaving marks that jaehyun knew too well—the kind that staked a claim. his pulse quickened, his body reacting before his mind could catch up, a satisfied hiss slipping from his lips. he hated it, the way he was drawn to the sight of you with someone else. hated the way his body responded, the way his fingers twitched to touch the screen, to feel connected to something—anything—that involved you.
dd it feel the same? did the man know what you liked, the way jaehyun did? the way your breath caught when lips hovered over your collarbone, the way your back arched when fingers tangled in your hair. the possessiveness that burned in his chest was primal, instinctual. you were his, even if the world around him screamed otherwise. and then, just for a second—a fleeting moment that almost slipped past him—you paused. your head tilted, and your eyes, dark and knowing, flicked upward. they locked onto the camera. jaehyun’s breath hitched. you knew.
for a moment too long, your gaze didn’t waver. that smirk—the one he had memorized, the one that had undone him more times than he cared to count—curled at the edges of your lips. you weren’t just aware of him. you were showing him. every movement was deliberate, every arch of your neck as the man kissed your skin, every glance toward the lens, every shift in your posture. it was all for him. the realization hit him with the force of a train. this wasn’t about the man with you. he was just a prop, a tool in your hands to provoke the reaction you wanted.
jaehyun exhaled slowly, the tension in his body turning into something else—something deeper, darker. his lips parted, and he muttered under his breath, barely above a whisper, “that’s my girl.” the words felt raw, scraping against his throat, filled with a kind of pride that he hadn’t realized he still held. you knew him too well. better than anyone. you played him like an instrument, each note of your performance calculated to draw out exactly what you wanted from him. and he couldn’t help but admire it, as twisted as it was.
he leaned back in the chair, legs still spread wide, his hand dragging down his face as he let out a slow, steadying breath. his eyes never left the screen, watching as the man pulled you closer, his hands disappearing into your hair, mouth claiming yours in a kiss that should have made jaehyun see red. but he didn’t. he couldn’t. because in that moment, he knew it didn’t matter. none of them mattered.
the way the man touched you, the way he kissed you, it would never come close to the way jaehyun did. he knew you in ways that no one else ever could. you might share your body with someone else, but your mind, your games—they were all his. you left breadcrumbs, and he followed them willingly, drawn into the labyrinth you’d created. another smirk tugged at the corner of his lips as he watched you, his girl, wrapped in another man’s arms, knowing full well you’d never belong to anyone else but him. he would let you play your game, let you dance with whoever you wanted, but in the end, it would always come back to the two of you.
he adjusted his seat, the sick heat of satisfaction settling deep within him. he couldn’t look away from the screen, even if he wanted to. and why would he? you were performing for him, after all. “knows me so well,” he murmured again, his voice a low, reverent sigh as he let his hand drop to his side. his eyes darkened, pupils dilating as he watched you, watched the man touch you, watched you steal glances at the camera. always for him.
the apartment was quiet again, but this time the silence was different—thicker, charged, as if the air itself was holding its breath. you felt it in the way your pulse raced beneath your skin, in the subtle tremor in your fingers as you stood in the middle of the room. he wasn’t far behind. you could hear him, the soft sound of his footsteps growing louder, closer, until the door clicked open behind you. you didn’t turn around. you didn’t need to. you could feel him watching you, his gaze heavy and possessive, the tension between you winding tighter with every passing second.
jaehyun didn’t say a word as he moved closer, the heat of his body pressing against your back. his hands slid around your waist, fingers grazing your hips before traveling upward, the soft fabric of your dress bunching under his touch. his lips found the side of your neck, the same spot where the man’s had been just hours earlier, but jaehyun’s kiss was rougher, more demanding. he bit down lightly, eliciting a sharp gasp from your lips, and you could feel him smirk against your skin.
“you must’ve seen us, yeah?” your voice was breathless, words slipping out between shallow pants as his hands tightened around your waist, pulling you flush against him. he answered with a low, guttural groan, the sound vibrating against your neck as his mouth moved lower, assaulting your skin with hot, open-mouthed kisses. his breath was ragged, uneven, and you felt the hardness of him pressing against the back of your thighs through his boxers, straining against the fabric. the memory of what he had seen—of you with another man—was still fresh in his mind, fueling every touch, every kiss.
jaehyun’s hand slipped under your dress, fingers trailing down to your panties, and without hesitation, he pushed them aside, his fingers finding the wet heat between your legs. his thumb brushed over your clit, slow at first, teasing, before he began to rub in tight circles, his pace quickening as he leaned into your ear. “every bit of it,” he murmured, his voice low and rough, sending a shiver down your spine. “you gave it to him real good, baby.”
a smirk tugged at your lips as you twisted your fingers into his hair, yanking his head back just enough to force him to look at you. his lips were swollen, glistening with spit, and his eyes—those dark, dangerous eyes—were filled with lust and something darker, something unhinged. you’d always loved that look, the way it made your heart pound, the way it made your core ache for him.
without warning, you slapped him hard across the face, the sharp crack of skin against skin reverberating through the room. the force of it left his cheek red, and the sting of your palm lingered in the air. jaehyun’s lips parted in a shocked gasp, his pupils blown wide as the lust in his eyes deepened into something feral. his hand flexed at your waist, and for a moment, you thought he might lose control completely. instead, he groaned, a low, broken sound that made your stomach clench, and you could feel his cock twitch against you, his boxers impossibly tight. “almost like you expected less of me,” you purred, your voice dripping with satisfaction as you traced the red mark on his cheek, watching the way his breath hitched at your touch. you could feel the power shift between you, feel the way his body reacted to your every word, your every movement.
he didn’t respond with words. instead, his hands moved to your shoulders, shoving you back onto the bed with enough force to make the mattress creak. you let out a sharp moan as your body hit the sheets, your back arching as jaehyun climbed on top of you, his weight pressing you down. he grabbed your wrists, pinning them above your head as his lips trailed down the curve of your neck, past your collarbone, before they found their way to your breasts.
he groaned as his mouth latched onto one of your nipples, sucking hard, his tongue swirling over the sensitive bud. his other hand cupped your breast, squeezing, kneading, as if he couldn’t get enough of them. “love these so much,” he murmured against your skin, his voice muffled by the fullness of your breast in his mouth. “the other girls, they don’t have ones like this.”
your breath hitched, the praise sending a wave of heat through your body, making your knees weak. but before you could process it, jaehyun released your wrists and leaned up, his hand moving with brutal swiftness as it collided with your cheek in a stinging slap that made your head snap to the side. the sharp pain bloomed across your skin, and instead of recoiling, you moaned, the sound desperate and raw, your body arching toward him in a way that begged for more. “i don’t get to play with them like this,” he smirked, his thumb brushing over your reddened cheek before trailing back down to your chest, his hands claiming your breasts again as if they belonged to him.
your thighs clenched around his waist, hips bucking up against him, desperate for friction, for relief from the ache that had been building inside you from the moment he touched you. his name slipped from your lips in a breathless whisper, a plea that made his smirk widen as he pressed his body down against yours, his erection rubbing against your bare thigh through his boxers. he leaned down, capturing your lips in a bruising kiss, his tongue sliding against yours with a hunger that felt primal, unhinged. the kiss was messy, spit slicking your lips as his hands moved down your body, fingers curling around the waistband of your panties before he yanked them off in one rough motion. his fingers returned to your core, probing and rubbing, and every touch was calculated to make you squirm, to elicit the moans he’d missed on camera.
you broke the kiss to gasp for air, your head tipping back as he slid two fingers inside of you, curling them just right, hitting the spot that made you see stars. your legs trembled around him, every nerve in your body lit up with need as he pumped his fingers in and out of you, his thumb pressing against your clit in time with each thrust.
“god, jae,” you gasped, your fingers gripping his hair, tugging hard enough to make him groan. He loved when you pulled his hair, loved the sting of pain mixed with pleasure. “yeah,” he grunted, his voice low and ragged as he looked up at you, his fingers never slowing. “you like it when i watch, don’t you? see how desperate you are for them.”
you smirked, your body arching off the bed, chasing the pleasure. “i like it when you can’t stop yourself,” you breathed, your voice thick with desire. “when you’re so addicted to me, you can’t even think straight.” his eyes darkened, the intensity of his gaze sending a shiver through you as he pulled his fingers from you, leaving you empty and aching. in one swift motion, he shoved his boxers down, his erection springing free, hard and desperate for you. he didn’t hesitate, grabbing your hips and yanking you down the bed before positioning himself between your legs.
he hovered above you for a moment, eyes locked onto yours, the air thick with tension, before he thrust into you, filling you in one hard stroke that knocked the breath from your lungs. you cried out, nails digging into his shoulders as your body adjusted to the sudden fullness, the burn of the stretch only intensifying the pleasure. he groaned, his head falling to your shoulder as he set a brutal pace, his hips slamming into yours with a desperation that bordered on madness. the room was filled with the sounds of skin slapping against skin, of his ragged breaths and your breathless moans, of the bed creaking under the force of his thrusts.
he buried his face in your neck, biting down hard enough to bruise as he fucked you with reckless abandon, his body shaking with the force of it. you clung to him, your legs wrapped around his waist, your body moving in perfect sync with his, lost in the intensity of the moment, lost in the feeling of him inside of you. jaehyun’s hands moved down to your chest, gripping your breasts with a hunger that made your breath hitch. his fingers dug into the soft flesh, squeezing, kneading, his eyes glued to the way they moved with each hard thrust of his hips. he was obsessed, completely entranced, as if he couldn’t get enough of the way they filled his hands, the way your nipples stood hard and ready for him.
his mouth descended on one of them, his lips hot and wet as he sucked greedily, swirling his tongue around your sensitive nipple before biting down gently, just enough to send a sharp jolt of pleasure through your body. you moaned, your back arching off the bed as his teeth grazed your skin, leaving a red mark in his wake. he groaned against your breast, his hand moving to cup the other one, his thumb flicking over your nipple, sending shockwaves of pleasure straight to your core.
“fuck, i love these,” he repeated between kisses, his voice thick with lust, muffled by your skin as he continued to lavish attention on your chest. “they’re so fucking perfect, baby. none of the others—” he paused, his teeth grazing your nipple again, harder this time. “—none of the other girls have tits like this.” you smirked at his words, your breath coming in ragged gasps as you threaded your fingers through his hair, yanking him up to meet your gaze. his lips were wet, spit running down his chin, his eyes wild with need, the dark desire in them so potent it made your stomach flip.
“good,” you panted, your voice breathless but teasing, “because they don’t deserve them.” his cock twitched inside you at that, and you knew you had him. he liked when you reminded him, when you made him see that no matter who he was with, no matter what he did, you were the one he couldn’t let go of. you were the one who owned him.
you ran your hands down his chest, your nails scratching lightly against his skin, leaving faint red lines in their wake. he groaned at the sensation, his hips stuttering slightly as he thrust into you harder, deeper, chasing the release he knew he’d only find with you. “i saw you, you know,” you whispered, your voice thick with a twisted kind of admiration. “you fucked her so well, jae. i was impressed.”
his breath hitched at your praise, and you could feel the way his body responded to your words, the way his cock swelled inside you, twitching with need. his grip on your breasts tightened, his hips slamming into yours with renewed force as if he was trying to prove something, trying to show you that no matter who he fucked, it was you that he belonged to. “yeah?” he groaned, his voice low and rough as he leaned down, his mouth hovering over yours. “you liked watching me fuck her?”
you moaned in response, your legs tightening around his waist as you lifted your hips to meet his thrusts. “yeah,” you breathed, your lips brushing against his, teasing him. “but you know what i like even more?” he growled, his hand slipping from your chest to your throat, his fingers wrapping around your neck as he pressed his lips to your ear. “what?”
“i like knowing that no matter how good it was, no matter how hard you fucked her, you always come back to me,” you whispered, your voice dripping with confidence, with satisfaction. he groaned at your words, his hand tightening around your throat just enough to make your breath catch. “fuck, baby,” he muttered, his voice thick with desire. “you’re the only one. no one else feels like this.”
he leaned down, his mouth crashing against yours in a bruising kiss, his tongue sliding against yours in a wet, messy tangle of spit and need. you could taste him—taste the desperation, the hunger that only you could satisfy. his lips were swollen, raw, and you kissed him harder, your fingers digging into his hair, pulling him closer. he pulled back slightly, his breath hot against your lips as he looked down at you, his eyes dark and filled with a primal kind of lust. “you like it when i fuck them, huh?” he babbled through a haze of lust, his hips slamming into yours again, his pace relentless. “you like knowing that no matter how good they are, they’ll never be you.”
you moaned in response, your nails digging into his back as your body trembled beneath him. “yes,” you panted, your voice barely more than a whisper, “because they’ll never be enough for you.” jaehyun’s hand moved from your throat to your breast again, squeezing it roughly as he leaned down, his lips trailing down your neck to your chest. he sucked on your nipple, his tongue swirling around it before pulling it between his teeth and biting down, hard enough to make you cry out in a mix of pain and pleasure.
“god, i love these tits,” he groaned, his voice muffled by your skin. “could fuck them all day.” your legs trembled, the intensity of his words and the roughness of his touch pushing you closer to the edge. you could feel the coil of pleasure tightening in your stomach, ready to snap at any moment. “then do it,” you teased, your voice breathless as you arched into him. “fuck me like you fuck them, jaehyun. show me.”
his eyes flashed with something dark and devious, and without warning, he pulled out of you, leaving you empty and aching. you barely had time to protest before he grabbed your hips, flipping you onto your stomach with a rough shove. you moaned as your body hit the mattress, your hands gripping the sheets as he positioned himself behind you. he didn’t waste time. his hands gripped your ass, spreading you open as he thrust into you from behind, the force of it making you cry out, your body jolting forward with each hard thrust. the angle was different, deeper, and you could feel every inch of him as he slammed into you, his cock hitting the spot that made you see stars.
his hand came down on your ass with a sharp slap, the sting of it sending a wave of pleasure through your body. “fuck,” you gasped, your voice muffled by the pillow as your hips bucked back against him. “harder.” he growled, his fingers digging into your hips as he fucked you harder, faster, the sound of his skin slapping against yours filling the room. “you really love this, don’t you?” he grunted, his voice low and rough. “love knowing i fuck them, but i come back to you.”
you moaned, your body trembling with pleasure as you nodded, your words coming out in broken gasps. “yes, yes, i love it.” his hand came down on your ass again, harder this time, and you cried out, the sting of it mixing with the overwhelming pleasure building inside you. “good,” he muttered, his voice thick with lust. “because this is the one thing i get to do that they can’t.”
with that, he thrust into you one last time, his body tensing as he buried himself deep inside you, his cock pulsing as he came, filling you with hot, sticky heat. you moaned at the feeling of him cumming inside you, the sensation sending you over the edge as your own orgasm ripped through you, your body convulsing with pleasure. jaehyun collapsed on top of you, his chest heaving as he pressed soft kisses to the back of your neck, his hands still gripping your hips tightly. “this,” he murmured against your skin, his voice soft but possessive, “this is mine.”
✧
a/n: i do NOT condone cheating yall
girl ur literally my fav nct writer 🫶🫶 i just wanted u to know that i appreciate u answering the asks wholeheartedly hehe. in a mark lee brainrot rn, dom!mark x reader 🫡🫡
MARK LEE (마크이) — SWEETHEART (18+)
✧ MDNI
it had been perfect—like a dream you never wanted to wake up from. your relationship with jaehyun was everything that love songs were written about, the kind of smooth sailing people envied from the sidelines. it was golden, wrapped in honeyed moments, soft whispers, and lazy smiles shared in the glow of a setting sun. the two of you painted a life together, each day a new canvas, filled with color, warmth, and comfort. nights were spent with heads tilted back, eyes tracing the stars, mapping constellations in the inky blackness, sharing secrets that were only meant for the sky to hear.
paris was your sanctuary. the rented hotel room had the scent of wine lingering in the walls, cigarettes lazily curling in the air like an afterthought. it was there that you learned how to make jam by hand, the two of you laughing at the mess you created, fingers sticky with sugar and fruit. you remember the way jaehyun kissed your wrist, tasting the sweetness as if it were the only thing that mattered. those moments were pure. untainted. until they weren’t.
it wasn’t the heart-wrenching kind of betrayal you had heard about—where tears flood your eyes and your chest aches so much you can barely breathe. no, it was quieter. like a slow unraveling, a ribbon pulling apart from the fabric of your life, thread by thread. he had been cheating, living a double life that you were blissfully unaware of. the weight of it didn’t crash into you all at once, but it sank, settling deep inside your chest, colder than anything you had ever felt. you weren’t shattered—you were numb. how could he have done it? how could you have been so blind, so foolish, to miss the signs that were right in front of you? it was enough to make your head spin, the world tilting on an axis you no longer recognized.
the days blurred together after that, a haze of distraction and feigned indifference. you got on quicker than you thought possible, faster than anyone expected. maybe it was because you hadn’t truly felt the pain, or maybe because you didn’t want to. either way, you moved forward. it was easier to pretend that nothing ever hurt at all.
mark, though—he had prayed for this. he would never say it aloud, not even in the deepest, darkest corners of his mind. but he had. every time he saw you with jaehyun, every time he watched the way you kissed him, the way you melted into him, something inside mark twisted. and he prayed. he prayed that your perfect relationship would crumble, that something, anything, would cause a fracture, a break that could pull you apart.
he never wanted to admit it to himself. what kind of friend did that make him? jaehyun was his best friend—one of the only people he had ever truly trusted. but how could he look away when all he could think about was you? the way your hips swayed in the jeans jaehyun bought for you, the way your lips wrapped around the popsicles mark had handed you on a hot summer day. it was wrong. he knew it was wrong, but it didn’t stop him. something had been unlocked inside him, something dark, something he hadn’t known was there. and now that it was free, he couldn’t lock it away. he didn’t want to. no one else had to know, not yet. but you would. soon enough. he was ready to introduce that side of himself to you.
“fucking slut,” mark’s voice was low, dripping with something dangerous as his hand tightened around your throat. his thumb pressed into that sweet spot just beneath your jaw, the one that made your vision blur and your breath hitch. you could barely think, barely process the rush of heat between your legs, the pressure of his knee grinding into you, sending shockwaves through your body. there was nothing between you but the thin fabric of your panties and his jeans, and you were soaking, drenching his knee with your desire.
“is that what you are? a slut?” his words were a hiss, dripping with venom and amusement. you were, and you had only just begun to realize it. not in the way you might have thought before—this was something deeper, darker, something that only Mark had drawn out of you. you weren’t some naïve virgin, far from it. you had done this countless times with jaehyun, but it had never felt like this. he had always been too soft, too careful with you, like you were made of glass, fragile and delicate. it was almost ironic, given the way he had shattered everything with his lies and betrayal.
but mark was different. loud, funny, hyperactive—that was what everyone saw. that was what you had seen. this, though? this was something else entirely. something darker, something you’d never have expected from him. but you had learned your lesson about judging people by appearances. “yeah,” you rasped, your voice barely more than a breath as his grip on your throat tightened, sending another pulse of heat straight between your legs. “just for you.”
he scoffed, his lips curling into a smirk as his hand trailed upward, his grip loosening just enough to let you breathe, but not enough to let you think. his thumb tapped roughly against your lips, a silent command, and without hesitation, you parted them. the moment your mouth opened, he shoved his thumb inside, groaning when he felt your tongue curl around it, wet and obedient.
“you should see yourself right now,” he murmured, his voice low and taunting. his eyes flickered over your face, watching the way your lips wrapped around his thumb, your eyes glazed with lust. “he should see you right now.”
the shame that pooled in your stomach twisted into something darker, something far more exhilarating. the thought of jaehyun walking in, seeing you like this, seeing his best friend ruin you—god, it turned you on more than you wanted to admit. a part of you wanted it to happen, wanted him to see how far gone you were, how much you had fallen.
“he should, actually,” mark repeated, the dark glint in his eyes growing more intense. he pulled his thumb from your mouth, the slick wetness of your saliva still glistening on his skin. you watched in a haze as he reached for his phone, sitting on the edge of the desk. he picked it up with a smirk, his eyes locking with yours, daring you to protest.
“what do you think, princess?” his voice was a murmur now, a purr, as his fingertips traced the bare skin of your thighs, sending shivers racing up your spine. you could feel your heart pounding, could feel the weight of the decision hanging in the air between you. and yet, despite everything, despite the shame, despite the humiliation, you wanted it. you needed it. so you nodded. mark chuckled, the sound dry and amused, like he had expected nothing less. “exactly what i thought,” he said quietly, his eyes never leaving yours as he swiped the screen, fingers moving with ease as he pressed record.
mark’s grip on your throat tightened again, his thumb pressing down hard enough to make your pulse stutter, your vision blurring at the edges as the air thinned in your lungs. he reveled in your reactions, the way your lips parted, the small gasps and moans slipping out, desperate for more, needing more. there was a sick pleasure in the way he controlled you, the way he had you falling apart beneath his touch, completely at his mercy.
“look at you,” he sneered, his voice low and cruel as his eyes flickered from the phone screen to your face. the red light on the camera blinked steadily, capturing every moment, every sound, every filthy thing he did to you. “fucking pathetic. you think jaehyun could ever fuck you like this? like you deserve?” his words sent another wave of heat rushing through you, shame and arousal twisting together in a way that made your heart race, your core clenching with need. you couldn’t answer, not with the way his hand was wrapped around your throat, but the way you writhed beneath him said enough. you needed this. you needed him.
mark shifted his weight, his knee pressing harder between your legs, grinding against your dripping core. his free hand moved to your ass, squeezing roughly before landing a sharp, stinging slap that made you cry out. “answer me,” he demanded, his voice sharp as he delivered another slap, harder this time, the sound echoing in the room. “no,” you gasped, your voice hoarse as you struggled to breathe, your body trembling from the roughness of his touch. “he couldn’t.”
mark chuckled darkly, his eyes narrowing as he leaned in closer, his lips brushing against your ear. “that’s right. he couldn’t. he doesn’t know how to handle a slut like you.” he spat the word with venom, and yet it sent a thrill through you, the degradation hitting you harder than the slaps, making you shudder. he let go of your throat just long enough to shove two fingers into your mouth, forcing them deep, pressing against the back of your tongue until you gagged around them. his eyes gleamed with something dark and twisted as you choked, and he pulled his fingers free, wiping the spit across your cheek.
“open,” he growled, and you did, your mouth parting obediently, your tongue resting against your lower lip as you looked up at him with wide, needy eyes. his lips curled into a smirk as he leaned over, spitting directly into your mouth. “swallow.” you did, closing your mouth and swallowing hard, the taste of him lingering on your tongue. he grunted in approval, his hand sliding down your throat again, squeezing as he pushed you back against the bed. his knee was gone, replaced by the rough fabric of his jeans pressing against your bare, soaking core, grinding into you as he smirked down at you.
“i should send this to him,” mark murmured, his eyes flicking to the phone, his hand tightening around your neck again. “let him see what his little princess looks like getting fucked like a whore.” your body betrayed you, a shiver of excitement rushing through your veins at the thought of jaehyun watching this, of seeing you like this, ruined by his best friend. mark grinned, sensing the shift, his hips rolling against yours, teasing, taunting you as you whined beneath him.
“yeah,” he said, his voice thick with amusement. “you like that, don’t you? you want him to see, you want him to know how much you need this. how much you need me.”
he didn’t wait for an answer, his hands moving to your hips, lifting you up just enough so he could pull your panties aside, exposing your slick, dripping folds to the cool air. he wasted no time, thrusting into you with a rough, punishing force that had you arching off the bed, your mouth falling open in a silent scream as he filled you completely. there was no gentleness, no hesitation, just the relentless pace of his hips slamming into yours, the sound of skin against skin echoing through the room.
“look at you,” he growled, his hand wrapping around your throat again as he fucked into you, hard and fast, the bed creaking beneath the force of his thrusts. “so fucking desperate for it. bet you never looked like this for him.” his words were a sharp sting, but they only fueled the fire burning inside you, the heat building with every rough, pounding thrust. you could feel the phone’s camera still recording, capturing every moment, every filthy word that fell from mark’s lips.
“bet he didn’t know what to do with you,” he continued, his voice a low snarl as he slapped your ass again, harder this time, leaving a red handprint on your skin. “bet he didn’t know how to fuck you like this. didn’t know how to make you beg for it.”
you were already so close, your body trembling, every nerve on fire as he drove into you mercilessly, your breath coming in ragged gasps as you clawed at the sheets, desperate for more. mark’s grip on your throat tightened, cutting off your air just enough to make your head spin, your vision blurring as the pleasure built and built, coiling tight in your belly. “come on,” he taunted, his voice rough as he leaned down, his lips brushing against your ear. “I want you to cum for him. cum for me while he watches.”
that was all it took. your body shattered, pleasure ripping through you in waves so intense you could barely breathe, your vision going white as you screamed his name. mark didn’t stop, fucking you through it, his thrusts rough and brutal as he chased his own release, his hand tightening around your throat as you convulsed beneath him. with a guttural groan, he came, his body tensing as he buried himself deep inside you, his hips jerking against yours as he filled you, the warmth spreading through your core. he stayed there for a moment, panting, his hand still wrapped around your throat as he rode out the last of his orgasm.
then, with a smirk, he reached for the phone, lifting it from the desk as he pulled out of you. he angled the camera down, making sure it captured everything—your wrecked, trembling body, the sticky mess between your legs with his hot cum seeping out of your cunt—the evidence of his release dripping out of you. “perfect,” he murmured, his fingers tracing your thighs one last time before he stopped the recording, his eyes gleaming with satisfaction.
✧
a/n: this was soo rushed i’m sorry lol but it’s 9 am and i have an mun meeting in an hour!! also ily u sound like such a sweetheart omg so cute
DILF!JAEHYUN AAAAAAAAAAPLPSOXOOSWYFGCUCTX VUIBUVUVXYXHCHVICXCVOLWLWKSLDKXKSKSMWKLSODXOSOEKWKWJWHJSISOSOSOSKLWLSLSKSJSKSKSKSKQKKSKSKDKSKWKWKSKDXKXKIXOSPWPEPEMWNBGYYIWKKWKWLSDLSKQLMQNKWLWPWLWKKSIXKSKMWKWLSLKSKSKWMSKSKSKSKWKSKSKSLSWLLWLWKSKXKXKJSKWNWKSKSKZKAKSKSKSLSKWKSKSKSKSKSKSKSKKSKSSJQJWJWJSJSBBS

trick or treat - j. jaehyun


→ jeong jaehyun x neighbour! reader
-> dilf! jaehyun au
→ CW: dom! jaehyun, breeding kink (jae's horny, i'm horny, everyone if fucking horny), age gap (reader is in mid-20’s and jae is a divorced 29yo Jae), unprotected sex, creampie, fingering, handjob, oral (f receiving), praising, pussy slapping, biting, spit kink, oral fixation (jae), there are some cringey lines (i'm sorry but i wanted to have them in there but i didn't know how else to phrase them T-T), jae's thick in this one guys :D
-> a/n: omg haii ^-^ okay so this one isn't necessarily halloween related but his kid in the fic is going trick or treating so it counts!!! Jae is DOWN BAD in this one y'all. also just an fyi, this one has a lot more dialogue since they have more of a relationship and it's not just mindless sex this time?? but there still is quite a lot of sex??? okok enjoyyyyyy
-> wc: 6k
-> upcoming: switch! yuta (playboy yuta :) will explain more on that later) psst! requests are open!!

“You’ve got to be kidding me.” Jaehyun’s face dropped as he read the email he had just been sent. Cursing under his breath, the man pushed away from his desk and poked his head out the door.
“Hayoung,” he said. The woman at the desk looked up at him and from the look on her face, she knew what he was going to ask.
“Sir, I’m so sorry…” and she truly did sound sincere. “Gongmyung had no other times available to meet. He’s leaving for London tomorrow morning.”
Jaehyun pursed his lips as he nodded. He felt awful that he couldn't take Subin out tonight, but he had one idea that could make his daughter feel better.
The man checked the watch on his wrist, reading the time as 5:30pm. If he left now, Jaehyun could be at Subin’s school for 6:15pm to pick her up from daycare, talk to her, and bring her home for 6:45pm before he had leave the house by 7:30 to be back at the office for 8:00 pm to meet the clients for dinner.
“Alright, I have to leave now, but I’ll be back in time for the meeting.” Hayoung looked as if she was going to object, but instead she just nodded her head. Jaehyun grabbed his jacket from his office before pulling his phone out from his pocket. As he walked to the elevator, he scrolled through his contacts, searching for your name.
As Jaehyun stood, waiting for the elevator, his heart raced with both the urgency of the situation and the lingering nervousness he got when you spoke. His thumb hovered over the call button when he hesitated. He took a deep breath and leaned against the glass railing behind him, feeling a pang of worry gnaw at him. Would he be imposing on you once again?
The elevators hummed softly as they stopped at different floors of the building while Jaehyun debated with himself, the prospect of the impending meeting weighing heavily on his shoulders. He decided to call you, but not just for Subin’s sake, for his too.
“Hello?” Your voice on the other end had a certain warmth, and it sent a shiver down Jaehyun’s spine.
“Hey,” Jaehyun let out a sigh at the sound of your soft voice. His voice tinged with the tension that had been building in the pit of his stomach ever since he received that email.
“What’s wrong? You sound stressed.” You grew concerned when you realised how his voice was quieter than usual.
“It’s just work stuff…” Jaehyun’s shoulders slumped. “I really hate to ask you this,” And he really did. “I was wondering if you could watch Subin tonight? I know it’s Halloween, and it’s super last minute, but I was just scheduled for a meeting, and you’re the only one she’d want to go with.” the disparity in his voice ran deep, but you didn’t have any plans anyways, so why not?
“Of course, Jae.” You said, and the man sighed with relief. “What did she dress up as for school?” The calmness in your voice soothed Jaehyun’s nerves. The elevator sounded as it arrived. After the doors opened, Jaehyun entered and leaned against the wall as he felt a strange mix of emotions.
“She decided she was going to be Elsa and when we went trick or treating, she wanted me to be Anna.” There was a moment of silence, but Jaehyun already knew what was about to happen. As the man closed his eyes momentarily, you burst out laughing on the other line.
“You were really going to dress up as Anna for her?” you asked, your voice was laced with amusement that made Jaehyun chuckle.
“It was either that or Quasimodo from the Hunchback of Notre Dame.” A hand ran over Jaehyun’s face in embarrassment, remembering the conversation he had with his seven year old daughter last month when they were discussing costume ideas.
“What, did she want to be Esmerelda?” you asked with a scoff.
“No, she wanted to be Laverne.” Jaehyun groaned, wondering from whom his daughter gets her ideas from.
“The gargoyle?” you cried. You held the phone away from your ear as you laughed loudly, clutching your stomach.
“Yeah,” the man replied, looking at his shoes with a smile, the sound of your laughter resonating with him. “How much do you want me to pay you?” he asked as he walked out the elevator and to the entryway of the building. He waved to the secretaries and to those who greeted him with a smile.
You tried to reason with him, arguing that you didn’t need the extra compensation, but Jaehyun’s insistence on repaying your kindness only heightened the nagging tensions between the two of you.
“Jae, you really don’t have to, you know I’d do anything for you guys.” Your voice was gentle, “You know I feel bad asking you to watch her without paying you.” Jaehyun’s voice dropped lower, carrying an undertone of a deeper emotion with it.
As he exited the building, silently thanking the valet driver for his keys.
“But I’m telling you that you don’t have to.”
Your attempt to reason with him was met with Jaehyun’s unwavering determination. “We’ll talk about it later.”
With no room for further discussion, you conceded, “I’ll see you at seven, then.”
“I’ll see you then.” Jaehyun confirmed, the tension settled down thickly in the air.
“Bye, Jae.” You said softly.
“Bye, y/n.” Jaehyun replied, the sudden strain in his voice giving way to a sense of longing as he entered his car.
Sitting in the driver’s seat, Jaehyun gripped the steering wheel and looked down, feeling a slight strain in his pants. “Jesus fucking Christ…” the man muttered. “What am I, twelve?” his head fell back against the headrest in frustration.
Jaehyun rolled down the window before he began to drive, in hopes that the cold breeze would clear his mind of the thought of you, and focus on what was more important: trying to find a way to tell Subin that he can’t take her trick or treating.
-
By the time Jaehyun had parked in the school parking lot, he had nothing. He still didn’t know how to tell his daughter the news. Taking a deep breath, Jaehyun pushed open the car door and got out of the vehicle before locking it and heading to the waiting area.
Minutes later, the bell rang and children of all ages flooded out the doors. Jaehyun stood amidst the sea of children pouring out of the school, his eyes scanning the crowd for a familiar little girl in an Elsa costume. He spotted her soon enough, her blonde wig glistening in the autumn sun, and a smile spread across his face. Subin was chatting excitedly with her friends, and he knew he had to break the news gently.
He approached her, kneeling down to her eye level. “Hey, princess,” he greeted her with a warm smile.
Subin’s face lit up at the sight of her father. “Daddy!” she squeaked and launched herself into his arms. Jaehyun laughed as he almost stumbled onto the floor, but his arms wrapped around his daughter tightly.
“Come on, let’s get you to the car.” Jaehyun stood up carefully with his daughter still in his arms. As he walked, Jaehyun sucked in a deep breath before he told his daughter the bad news. “Subin, about tonight…”
The girl looked up at him with curious eyes. “What is it, Daddy?”
Jaehyun cleared his throat, trying to find the right words. “Well, I know how much you were looking forward to trick or treating tonight, and I was really excited too, but something came up at word.” He paused, gauging her reaction.
Subin’s smile faded, and her brows furrowed. “Do you have a meeting tonight, Daddy?”
Jaehyun’s heart felt like it was breaking off piece by piece. “I’m so sorry sweetheart, I tried to reschedule it for later, I really did, but it didn’t work out.” Jaehyun frowned, but his daughter smiled.
“It’s okay, Daddy. Do you think you’ll be back to watch HalloweenTown with me?”
“I’ll do my best, okay? I promise I’ll make it up to you sweetheart.” Jaehyun promises. “Until I come back home, I asked the lady from the floor below us to watch you, you remember her, right?”
“The pretty lady you invite over every weekend? I remember her.” Subin nodded, unaware of how red her fathers ears had turned.
“She doesn’t come over every weekend.” Jaehyun mumbled, looking away from his daughter as they arrived in front of the car.
“She does… Dohwa even asked me if she was my mom.”
“Oh…” he replied simply. Jaehyun stayed silent as he sat his daughter in the booster seat behind the passenger’s side, the thought almost consuming him.
Dohwa asked if she was her mom…
After he clicked her seatbelt in, Jaehyun shut the door and headed for the driver’s seat, still entirely thinking of you… as a mother…
The man paused right as he was about to open the door when he felt the same stiffness from earlier, and he had to stop himself from screaming curses at the sky. Jaehyun closed his eyes and swallowed harshly before he opened his eyes and entered the car like nothing had happened to him.
“Daddy, can we listen…”
“Of course,” Jaehyun gave his daughter a smile through the rearview mirror. He knew exactly what the kid was asking for, and with a few presses of some buttons, the intro of the infamous ‘Let it Go’ from the Frozen soundtrack was blasting from the speakers, and Subin was belting out the words.
The rest of the ride was filled with more Frozen, which consisted of duets, the respective solo’s of both Jaehyun and Subin, and the booing of Hans whenever he sang in Love is an Open Door.
Jaehyun had arrived at the condo building at 6:45pm, “Right on schedule,” he said to himself as he walked to the other side of the car to help his daughter out of the car. “Come on, sweetie,” he said, lifting her into his arms. With how adorable she was in her Elsa costume, he was determined to make it up to her for the missed trick or treating.
After a quick elevator ride, they reached his penthouse. The elegant, modern space was impeccably decorated, a reflection of Jaehyun’s refined taste.
“What d’ya want to eat before the pretty lady gets here, Miss Elsa?” Jaehyun asks Subin, who was already halfway to the kitchen. He followed behind her and held the door open for her as she entered. “Goldfish…” she said hungrily, causing a laugh to escape from Jaehyun’s lips.
“Goldfish it is, then.” The man took a bowl from one of the cabinet’s before he scanned his pantry for the snack that was requested. While Jaehyun looked, he heard Subin squeal with excitement. A mix of confusion and concern churned through Jaehyun, so he tried to be quick with his search and found them on the top shelf.
“Subin, I found them…” Jaehyun stopped in his tracks when his eyes found yours.
“Hey Jae,” you smiled, your insides twisting at his current state. He’d come from the office, you knew that already, but seeing him in that suit definitely messed with you a bit.
“Hey,” Jaehyun couldn’t help the way his heart raced at the mere sight of you. You were holding a neatly folded Anna costume in your arms, and the smile you gave him made his heart skip a beat. “You’re early.” he said. Although he looked quite distracted, Jaehyun still managed to pour Subin her goldfish and hand the bowl to her.
“Yeah, I just thought I’d come by a little early to see if Subin needed help with her costume.” Your innocence warmed Jaehyun and forced a smile onto his lips.
“That’s really thoughtful, thank you.’
“Don’t even mention it.” you said.
“Pretty lady, are you going to put your costume on now?” Subin interjected while she munched on the small crackers.
Jaehyun shuddered lightly, realising his daughter had just watched that whole interaction, even though she probably didn’t register what was going on.
At least that’s what you both hoped.
“Oh! Yes, yes, I will go do that. So, give me a few minutes, yeah?” you winked at her which earned you a big grin from the little girl.
“You can change in the guest bathroom.” Jaehyun blurts. “I’ll show you where it is.”
“Yeah, yeah, sounds good.”
Jaehyun walked out first, but it didn’t take long for you to catch up to him. You walked silently up the stairs and down the hall until you reached the room.
“Let me know if you need anything,” he said.
You thank him before you enter the bathroom, one you’ve definitely seen before. You set the costume down on the counter and begin to undress. Everything was going well until it came down to actually doing up the back of the dress.
“Jaehyun?” you raised your voice ever so slightly, just to check if he was still there, and in a heartbeat there was a soft knock on the door.
“You called?” His voice was a bit muffled from being on the other side of the door, but you opened the door, finding him leaning against the door frame.
“Could you help me with this?” you asked with a hand across your chest to keep your dress from falling.
Jaehyun looked away from your eyes, suddenly feeling very warm in the face and ears. “Yeah, could I come in?”
You moved so he had room to enter, and you shut the door almost immediately after and locked the door. Your back was facing Jaehyun, but you were watching him through the mirror. You felt bold until his dark eyes met yours in the reflection, and since then, his gaze didn’t leave yours.His heart raced as he looked into your eyes, and his fingers trembled slightly as he began to tie the strings at the back of your dress.
The tension in the air only grew stronger as his fingers brushed lightly against your skin, and your breath hitched. You couldn’t help but steal a glance over your shoulder, meeting Jaehyun’s gaze once again.
“Done…” he gulped, holding your stare. It was a moment where words were no longer necessary, and the attraction between you two was undeniable.
Jaehyun leaned in closer, his lips brushed against the nape of your neck. Your heart raced, and you tilted your head slightly, granting him access to your skin. His kisses were gentle, sending shivers down your spine, and his arms which had wrapped around your waist, had become your new form of support.
As he continued to trail soft, lingering kisses along your neck, Jaehyun whispered, “You’re making it hard for me to focus on anything other than you.”
You turn around to face him, your lips dangerously close to his. “Maybe that’s the point,” you replied with a mischievous glint in your eyes.
With a surge of longing, Jaehyun closed the small distance between your lips and his. The kiss was passionate and electric, and yet still so familiar from the previous ones you’ve shared from almost every weekend for the past three months.
One of Jaehyun’s hands cupped your cheek as the other snaked down to your waist, pulling you in closer. He felt the heat of your body merge with his, and his heart raced as he deepened the kiss. Your hands were tangled in his hair, and the taste of his lips sent a wave of euphoria through your body.
Jaehyun pulled away, but only slightly. His forehead was still pressed against yours, and he whispered, "I could kiss you like this forever."
Your lips curled into a small smile and you replied, "I wouldn't mind it."
With that, Jaehyun kissed you again, and this time it was more desperate, more passionate. He moved his lips hungrily against yours, exploring and tasting your mouth. You let out a soft moan as his hands moved to your lower back, and your kiss became more passionate.
His hands moved to the small of your back, and he lifted you up, your legs wrapping around his waist. You felt the warmth of his body against yours, and you melted into his embrace.
He carried you to the counter, and sat you down on the cold marble, and your arms tightly wrapped around him. You could feel his heart pounding against your chest, and the intensity of the kiss was enough to make your head spin. You felt like you were in some kind of trance, and you welcomed it with all your heart.
With his hips in between your legs, you reached out your hand to palm his growing erection through his pants. Jaehyun pulled away from the kiss, letting his head fall back in pleasure.
“God, baby, I got hard twice today because of you.” You hummed in response, slowly undoing Jaehyun’s belt and freeing his cock from his boxers. Bringing your hand to your mouth, you spit into it before lubing up his dick with it.
You started to move your hand up and down, slowly stroking his shaft and Jaehyun let out a low moan. His eyes were closed and he was breathing heavily, his hips starting to move in time with your hand.
Your hand closed over the tip, stroking it in circular motions before you moved your hand to jerk off the rest of his length. You increased the speed of your hand, Jaehyun's breathing getting heavier with each stroke. You could feel how hard he had gotten, and you smiled as you continued to pleasure him. Feeling your spit start to dry up, you started to use more of your hand, your fingers tracing circles around the head of his cock. Jaehyun's hands were gripping the material of your costume tightly, and you could feel his hips twitching with each of your strokes.
You moved your hand faster, your thumb now rubbing circles around Jaehyun's most sensitive spot, and he let out a loud moan as he was about to cum, but before he could, a timer went off.
“Fucking christ,” You both sighed out of disappointment, and Jaehyun rested his forehead against yours.
"I have to go," he said, regretfully. He quickly fixed himself up and helped you off the counter.
“What if you’re still hard during your meeting, though?” You joke while your fingers toyed with his belt loops.
He chuckled, and kissed you one last time before reluctantly pulling away.
“I’ll figure something out." You pouted, and he leaned in to give you one last peck on the lips before he grabbed his phone and unlocked the door. "I'll see you soon. I promise." He said before slipping out of the door.
You sighed and smiled to yourself, savouring the moment. You felt more alive than ever.
Sliding off the counter, you turned and inspected your face to make sure you didn’t go back to Subin looking like a hot mess.
“Pretty lady!” Subin yelled as you walked down the stairs. The young girl squealed as she ran to wait for you at the edge of the steps. She gushed at you once you had fully arrived in front of you. “You look so pretty!”
“Thank you sweetheart.” you said as you ruffled her hair. “Ready to go?” you asked her with a grin. Subin nodded frantically and grabbed your hand before she darted towards the elevator, her candy bag in the other hand waiting to be filled to the brim with treats.
“Trick or treating!” she cheered and jumped with excitement, and your heart warmed at the sight.
-
“Thank you so much for your time Gongmyung.” Jaehyun smiled as he shook the older man's hand.
“Of course! The pitch was great, so our lawyers will be in contact with yours very shortly.”
Jaehyun saw the man out of the smile and one final bow before he looked down at his watch. It was 9:30pm.
‘They should be home by now.’ Jaehyun thought as he got in his car and began to drive home.
It only took him about twenty minutes to get home from the restaurant, and by the time he reached the penthouse, he found you sitting on the couch with his daughter sleeping peacefully next to you, her head resting on your thigh.
“Hey,” you smiled up at him. Jaehyun mirrored your expression as he sat down next to you and wrapped an arm around your shoulders.
“When did she pass out?” Jaehyun’s fingers drew circles against your arm as you leaned into him.
“About an hour ago? She already brushed her teeth, we were just watching The Nightmare Before Christmas.” Jaehyun looked at you, his brows scrunched closer together.
“Is that not a Christmas movie?”
“Tsk… no one knows what it is or isn’t.” you said, jutting out your bottom lip before Jaehyun pecked your cheek. “I think I’m gonna put Subin to bed… show me to her room?” You slowly moved in a way that wouldn’t disturb the little girl too badly, and you brought her to your chest and rested her head on your shoulder. Both you and Jaehyun stood and you cautiously walked up the stairs and down the hall.
Jaehyun opened the door, revealing a baby pink room with toys and stuffed animals astray.
“This room is so…”
“Scary?”
“Her,” you shot Jaehyun a dirty look which made him laugh. “Not too loud, idiot.” you scolded him when you felt Subin stir at the loud noise. Cradling her head, you ordered Jaehyun to pull her bed covers back. Gently, you set the girl down before tucking her in. You stepped back to watch Jaehyun crouch beside her head and plant a light kiss on forehead. He sat there for a few seconds, rubbing her cheek with his thumb. With one last peck goodnight, he got up and smiled softly at you before he took your hand in his and led you out of the room.
With the lights off in Subin’s room and her door shut, the two of you stood in the hallway, staring into each other’s eyes.
“Thank you, again, for watching her.” Jaehyun stepped closer to you. You noticed how his tone dropped, how his hands squeezed yours gently, and how his eyes flickered from your eyes to your lips.
“Like I’ve said, you don’t have to thank me… but you can show me your appreciation in a different way.” you teased and hooked your fingers around his belt loop like you did earlier.
Jaehyun smirked devilishly, leaning in to kiss your neck. His hands moved around your waist, dipping lower until he cupped your ass.
As he trailed kisses along your neck, he paused to nibble and suck on your sensitive skin. His hands moved up your back, tugging your hips even closer to his. You felt your own arousal growing as his lips moved from your neck to your lips, his tongue pushing its way into your mouth. You moaned against his lips as your hands found their way into his hair, fingers curling around the strands of his hair.
“We shouldn’t do this out here…” you said breathlessly, and Jaehyun groaned in agreement.
He pulled away and took your hand, leading you to the guest room. Your pulse was racing as he pushed open the door, and you both stepped inside. He pulled you close and kissed you deeply, while your hands moved to the back of his neck, tugging him in closer as your lips moved together in an urgent, passionate kiss. His hands travelled their way down your body, exploring your curves as you explored his. He trailed kisses down your neck, making you gasp as his teeth lightly grazed your skin. You groaned in pleasure as you felt his erection growing against your belly.
He grabbed your hair and pulled it back, his face hovering close to yours. "Tell me what you want," he growled.
You bit your lip and smiled, your desire rising with each passing second. You wrapped your arms around his neck and leaned in to whisper in his ear, "I need you to fuck me."
He groaned and pulled you closer, his hands roaming your body. His lips brushed against your ear as he responded in a chuckle, “Waited all day for you to say that to me.”
In an instant, Jaehyun brought you towards the bed, a fire raging in his eyes. You were both eager to get undressed, and you started with his shirt. You reached to undo the buttons of his suit and slowly started undoing them, never breaking away from his embrace. Jaehyun’s breaths were heavy and rushed as you finally released his shirt and pulled it off his body.
His hands moved to your shirt and he proceeded to do the same with you, slowly pulling your shirt off and tossing it aside. He grabbed your waist and pulled you closer, his lips finding yours again. His hands were frantic as they roamed your body, the intensity of his kiss growing with each passing moment.
He leaned back and pulled you with him, the two of you standing there in nothing but your underwear. His eyes were ablaze with desire and he stepped forward, pushing you back onto the bed. He leaned over you and slowly trailed his lips down your body, his hands massaging your curves as he made his way down.
He pulled back and looked into your eyes, his own filled with a primal hunger. With one hand, he grabbed your wrists and pinned them above your head, his lips finding yours again as the other hand found itself making its way down your navel, all the way to your pussy. His thumb took to your clit, drawing small circles on it.
The friction felt electric, you couldn’t help but shiver at his cold hands touching such sensitive parts. A soft moan escaped your lips as your hips involuntarily arched towards his touch. His thumb moved faster, increasing the intensity of the pleasure. You felt pleasure radiating through your body, slowly building to an unstoppable force. Your breathing became shallow, your heart raced, and all you could do was surrender to the sensations. His thumb began to move with more intensity, each circle growing wider and wider. His touch was gentle yet demanding, sending sparks of pleasure shooting through your veins. The hand that had your wrists in a tight grip suddenly let go, but it moved to your hip and he grabbed firmly, steadying you as his thumb continued to bring you closer to the edge.
You could feel his breath against your neck, his fingers digging into your hips as he moved them. Suddenly, he slapped you hard on your pussy and you gasped in surprise. The repeated action brought you close to tears. As your jaw hung open from a mix of surprise and pleasure, Jaehyun saw this as the perfect opportunity to do the thing you love. Hovering just slightly over your mouth, he let his saliva drop into your mouth, and he watched with a smirk as your jaw shut immediately, swallowing what he gave you.
His tongue soon found its way into your mouth, and you tasted the bitterness of his spit as it mingled with yours. His hands moved with purpose, sending waves of pleasure cascading through your body.
You could feel the anticipation building in your body, and you could barely contain the moans that escaped your lips. You were so close to the pinnacle of pleasure, and his touch was the only thing that could get you there.
“Fuck, Jae… oh fuck.” you said as a signal to him that you were cumming. If that didn’t tell him, then the way your body shook definitely did.
Not long after you came, Jaehyun sat himself in between your legs. Both of his hands moved to your thighs, pushing them apart as he knelt in front of you. He looked up at you with pure adoration and started to kiss and lick your inner thighs.
Jaehyun kept one arm around your hips while the other explored your pussy, fingering you slowly. You gasped and hissed in pleasure as he teased your sensitive areas. He moved his mouth to your pussy and started to lick and suck in a tantalising rhythm. His tongue moved in slow circles, alternating between soft and hard strokes.
The arm he kept around your wait found itself lazily dragging from your waist, up to your breasts. His nimble fingers squeezed and teased your nipples, not helping the fact that you were trying to keep your voice down– even though you were several rooms down from his daughter.
The back of your hand moved to cover your mouth as you moaned, while the other grabbed his head, pushing him deeper into you. He bit down on your labia and licked the sensitive skin around your clit, sending shockwaves of pleasure through your body. Jaehyun moved his fingers inside you, pushing them in and out in a steady rhythm, his thumb finding the spot that sent sensations of pleasure through your body.
He then began to massage your clit with his tongue, circling it slowly and then faster and faster until you felt your toes curl in anticipation. His hands moved down to your hips, holding you tightly as he increased the pressure and speed of his tongue.
You felt your muscles tensing and your breathing becoming more rapid as you got closer to the edge. His fingers moved faster and faster, stimulating you in all the right places. You moaned and gasped as your orgasm finally overcame you, your body shaking in pleasure.
“Came so quick.” Jaehyun stated, slowly moving his mouth back up to yours and kissed you passionately, his tongue exploring your mouth as his hands moved to your waist.
He grabbed your hips and spread your legs wider, pushing his hard cock inside of you. He moved slowly at first, letting out a guttural moan as he entered you.
He moved his hips in a circular motion, pushing himself deeper into you as he felt your tight walls stretching around his thickness. He felt as if he was being consumed by a blanket of pleasure, and he loved the feeling of being completely surrounded by you. With each movement, you could feel him stretching you out further, and the sensation made his body tremble with delight.
“Fuck, baby, you’re doing so fucking well.” His breathing quickened as he felt the sensation of being fully engulfed inside of you, and the sensation of pleasure coursing through his body. He felt as if he were melting into you, becoming one with you as he moved faster and faster.
He added a new layer of pleasure to his movements, as he sucked and licked on your nipples while he continued to thrust. His tongue felt like velvet on your skin, teasing and tantalising you with every movement. His hands moved to your back, caressing it with every thrust.
You grasped his shoulders tightly as the sensations built up inside, and you felt yourself getting closer and closer to the edge. Finally, you threw your head back and let out a loud moan as you reached your climax, your pleasure washing over you. Jaehyun’s breathing became heavier, and you could feel his muscles tense up, his whole body shaking with pleasure.
“Fuck baby…” Jaehyun groaned, looking down at your pussy. “You’re so fucking full.” he bit his lip to stop himself from showing his smile, but it was useless– Jaehyun was grinning from ear to ear with pride. He watched as his cum dripped out of you, but with two fingers, he took whatever had leaked and shoved it back into you.
“Hey,” you said, grabbing his attention with his fingers still inside of you. “You gonna fuck me full of your cum, or what?”
Jaehyun almost lost it. Asking that of him was not the smartest idea, considering the fact that he’d do anything you told him to.
“Is this you asking to have my second kid? We’re not even together.” He joked as he sat himself with his back against his headboard.
You knew what that meant.
Getting on your knees, you crawled on top of him and positioned yourself above his still very hard cock.
“I could do both…” you say without another thought.
“Oh baby,” he said, voice more seductive than you’ve heard before. “I’ll fuck you so hard, you’ll get pregnant right away.” And with that, he thrust upwards, shoving his thick cock into you.
You exclaimed in surprise, eyes going wide, but your hands flew to his shoulder, stabilising yourself as he moved inside of you. He moved long and slow, his hips rolling against yours, and you felt your pleasure building with each thrust. He reached down and grabbed your ass, squeezing the soft flesh as began to pick up his pace. His breathing became ragged as he went deeper and deeper into you.
His hands moved higher, gently caressing your breasts, his lips lightly sucking and licking them. His fingers moved lower, rubbing and teasing your clit, and his tongue licked and sucked your nipples.
“Fuck, just look at you, your fucking tits bouncing…” he mumbled, his mouth watering at the sight. “Gonna get you pregnant with my baby, and your tits are gonna be so fucking big.” Jaehyun moaned at the thought. You felt his tongue flick against your nipples, and you gasped in pleasure as he teased them with his mouth.
As he sucked on your nipples, Jaehyun started to pick up the pace, pushing himself in and out of you. His hips moved in a perfect rhythm, each thrust sending a wave of pleasure through your body. You felt your eyes roll to the back of your head, and your breath coming in ragged gasps.
You could feel the heat building inside you as he continued to move. His hand moved down, rubbing against your clit as he moved, sending pleasure coursing through your veins. His thrusts were getting harder, and faster, and you could feel yourself getting closer and closer to the edge.
Just then, he pulled out of you and flipped you over onto your back. He stared into your eyes, holding your gaze as he penetrated you again. “Fuck Jaehyun, I need your cum.” You whined. His thrusts were more forceful now, and you could feel yourself moaning louder and louder as he continued to move inside of you.
He then started to move one of his hands up and down your body, playing with your nipples and lightly caressing your breasts. His tongue lapped at them, and you felt your body tense up as he sucked on them. He moved the other hand down to your clit again, rubbing it in circles as he moved inside of you.
“Need to get you so fucking full.” Jaehyun spoke aimlessly as he fucked your cunt, his thrusts growing harsher by the second. You hummed at his words, equally as brainless as he was from the stimulation.
You felt yourself getting closer and closer to the edge, and Jaehyun increased his thrusts, pushing himself deeper inside of you. He grabbed your hips and held you tight, pushing himself deep inside of you. You screamed out in pleasure, your orgasm ripping through your body, and he followed shortly behind, his body shaking in pleasure.
His moans grew louder and his thrusts became more intense, the pleasure becoming too much for him to handle. He felt his orgasm build up inside of him, and as he reached the peak, he let out a cry of pure ecstasy. Jaehyun slowly pulled out of you before he laid beside you.
Turning to face him, you both lay there for a few moments, your breathing ragged and your hearts pounded in your chests.
“I meant what I said…” Jaehyun said, his thoughts now cleared from his prior state of mind. “About being together. The baby too, but that can come later.”
“I like that idea,” you hummed and pressed your lips to his.
Snippets from an Affair
The title already told you what you need to know, so before you continue, here’s Jaehyun for you to look at in that iconic suit he wore in the ‘Kick It’ MV.
Forgive me, Father, for I have sinned.

CHAROT! Anyway, you know the drill:
Mahal ko kayong lahat! :)
–––
Summary: Take a glimpse of Essie and Jaehyun’s affair from the second day until the fifth. I’m not sure if I’ll consider these as completely canon, but I might write a mini-series on their rendezvous soon.
POV: 2nd person again.
Word count: 1,300 + words
Warning: Baby’s revealing her first smut, and then another. Well, sort of. But there’s smut here, so you can skip that if you’re uncomfortable.
Recommended listening: I mentioned two songs: The Internet’s ‘Give It Time’ and The Beatles’ ‘And I Love Her’. I think both will be Jaehyun-approved too!
–––
When insomnia hits you, Jaehyun was one of the people you always called. You were all alone in the apartment, and you needed someone to talk to.
Good thing that your now-lover was there to keep you company since your boyfriend was out of town for a gig. Mark was abroad with Taeyong for a special project, leaving Jaehyun all by himself in his apartment as well.
It was the second day of your affair, and he decided to drive around the area after picking you up in your area. While one of his hands was on the steering wheel, the other held your hand. You chatted about everything as he drove, your eyes moving from him to the scenery outside.
Late-night drives made you feel warm despite the freezing air conditioning inside the car. You wished you could always do this with him, but you know that you couldn’t afford this with your situation.
“Darling, look. There’s a new café open there,” he pointed at a small but brightly-lit shop at the corner of a new building. “Want to try their offerings?”
You squeezed his hand in affirmation, which he stroked to mean that he got your message. As he parked the car nearby, he noticed that you kept on wrapping your arms around yourself. After all, you just wore a thin long-sleeved shirt and a mini skirt.
“Essie, take this,” he said softly, removing the hoodie that he wore. You took it wordlessly and slipped it on. “It looks good on you,” he commented, stroking the material of his jacket that seemed a bit baggy on you.
“Thanks for letting me borrow your hoodie, mon amour,” you said, tugging at the strings at the neck of his jacket. “I wasn’t prepared for a late-night drive like this.”
“Well, you should next time. And I don’t mind you wearing my jacket.” He grabbed your wrist and pulled you into a hug, which you reciprocated.
You didn’t mind that you hugged in the middle of the street at 3 in the morning. You stayed in that position for a bit until you felt him shuffling. You saw that he got his phone out of his jeans pocket and took a photo of you in an intimate position.
“Must you always take a picture every time?” You asked, amused at his boldness to take a picture of you together.
“Yes, mon amour,” he said, smiling. “Hey, I like the sound of that. I’ll call you that from now on.” He led you inside the new café wherein you were the only customers they had.
\\\
You never expected that your tryst with Jaehyun will turn out like this on the third day.
Playing in the background was The Internet’s ‘Give It Time’ as he planted kisses all over your body. You were in a swanky hotel room, and he had already stripped you down to your underwear. You wore your best lingerie as he took you out to a fancy dinner after work. He wore a suit and bow tie, while you wore a red dress with a high slit. It drove him crazy, and you felt his hands caressing your thigh throughout the dinner.
Now that you were back in your room, he went loose. Although he was already whispering the dirty things he’ll do to you in the elevator, nothing could compare to the beast he unleashed as he threw you on the bed and undressed you within seconds.
“I want to do you so bad, darling,” he moaned as he caressed your breasts. “Please,” you mouthed, your hands playing with the collar of his shirt. “May I?”
When you heard him say yes, you were quick to unbutton his shirt and his jacket. “I want to leave this on,” you purred as you tightened the bow tie on his neck. He let out a strangled cry when you tightened it a bit too much, making you bite your lip in excitement.
You unbuckled his belt and unzipped his pants, leaving him only in his boxer briefs. His bulge grew bigger when you used your teeth in pulling down his underwear, eliciting a loud moan from him. “Darling, be careful,” he hissed, berating you for using your teeth.
After all, the first time you did this, he was hurt when you grazed your teeth on his member. But you always thought that was sexy and decided to try again.
“Sorry, but I can’t help it.” You were on your knees, and you licked the tip of his member gently. He seemed to enjoy it until he grabbed your hair forcefully and pushed your head closer to his dick.
“Don’t be a tease, and take it all in,” he grunted, moving your head as you tried not to gag. He was getting bigger in your mouth, and you closed your eyes to relish the moment.
As the rhythmic slapping of his cock against your mouth continued, you peeked that his legs were becoming unsteady. “I’m about to cum, darling,” he said, his voice shaky from too much stimulation. You shut your eyes and anticipated his release. When it did come, you gulped it all in.
He slowly took out his dick from your mouth and watched you lick the remaining cum from your hand. “I’ve got enough protein now,” you giggled as you looked at him straight in the eyes. His sultry façade faded as he saw your reaction, and he bent down to your level to kiss your forehead.
“I’ll give you more of that, mon amour,” he said as he carried you to the bed. “I’m going to fill you up with my loving.”
\\\
In the week that you and Jaehyun had trysts, you realized how much of a boyfriend material he is on the fourth day.
As you cuddled on the couch at his place, he suddenly sang you an old love song. It was one of your favorites: ‘And I Love Her’ by The Beatles.
He looked at you in the eyes, arms wrapped around your waist, as he sang the song wholeheartedly.
She gives me everything
And tenderly
The kiss my lover brings
She brings to me
And I love her
You couldn’t help but smile at how romantic he was being and felt your cheeks flush as he swayed you in his embrace.
A love like ours
Could never die
As long as I
Have you near me
You poked the dimples that appeared on his face as he continued singing, which prompted him to squeeze you tighter.
Bright are the stars that shine
Dark is the sky
I know this love of mine
Will never die
And I love her
He kissed your forehead after he wrapped up the song. “I love you so much, darling,” he whispered.
You could only kiss his nose in response since you were afraid that you were falling hard for him as well.
\\\
Jaehyun never fails to mention that he gets extremely sweaty whenever you’re together. You remembered it the most when you fucked – you never wanted to call it making love since you knew you were sinning every time you did it – and you just wanted to dry him off with a towel.
“Mon amour, does it bother you?”
He asked after a round of sex on the fifth day of your affair. “What do you mean?” You tilted your body toward him, and he grabbed your forearm.
“I mean, look at me, darling,” he gestured at his naked sweaty body with his free hand, “I’m bothered by this. Aren’t you?”
You took the towel on the bedside table and wiped him on his neck first, then dabbed it down his torso. “I am, but I don’t want to think about that when you’re ramming your dick inside me, you know?” You chuckled, now wiping his arms.
“Sorry for that stupid question,” he laughed, grabbing the towel from you. “But I get sweaty so easily. I hope you wouldn’t be bothered by it in the long run.” He was now drying his legs with the soaked towel.
“Whoever chooses to be your partner shouldn’t be, mon cheri,” you kissed his now dry shoulder. “Because they should focus on your performance, as always.” With those words, you pinned him down and dominated the next round of sex.
–––
FIN
P.S. I wonder if you’ll get drunk every time you read their pretentious name-calling in French. Did you guys try it?
Day Dream
Through the help of my office mate, I was able to retrieve a copy of some of my previous writing. This is one of them, which I hope you’ll enjoy.
To be honest, I didn’t know what I was thinking – this just happened like a daydream. Yes, the pun was definitely intended.
Here’s an edited outtake of Jaehyun from the same song that appears in their Neo Zone album.

Mahal ko kayong lahat! :)
–––
Summary: This is inspired by Essie and Jaehyun’s steamy affair. I can’t believe I write smut for Jaehyun, but not for Johnny. How come, self?
POV: 3rd person since this is quite new, meaning this was written pre-quarantine this year.
Word count: 720 + words. I think this is the shortest so far? Let me get back to you on that soon.
Warning: This is as smutty as I’m going to get for now.
Recommended listening: Sorry if I’m going to ruin your thoughts on their song, but I did write this while listening repeatedly to it.
–––
The longer Jaehyun and Essie went on with their trysts, the more it felt like a dream.
She lost count on what day it is – was it the third or fourth day? – as they made out on her couch.
Johnny was in Chicago while Mark was in London, so they were confident enough to do this at her apartment. Jaehyun felt that his soul was watching above their bodies and observing what it must feel like to have her as his.
“Oh Jay, please don’t stop,” she said breathlessly as he peppered kisses from her neck down to her collarbone. “No, I won’t, baby doll,” he murmured, his lips now at the edge of her shirt’s collar.
He thought that they would spend the days just hanging out and kissing, but it turned out to be a carnal affair. They couldn’t help but fuck each other, and then end the day acting like a regular couple.
They ended up naked on the couch, their clothes scattered on the floor. Before Jaehyun entered her, he lay above her and took in her naked glory with his hungry eyes. “You are so beautiful, Miss Jessica Park,” he breathed, his hands pinning her wrists down.
“And you are a beautiful man yourself, Jeong Yoon Oh,” she replied in the same manner, giving him a smile that made him pound her immediately with reckless abandon. It was the first time they were doing it without any protection, and damn the consequences for he wanted to feel her raw.
Her moans were music to his ears, and he loved it especially when she screamed his name.
“Scream for me more, baby,” he grunted, thrusting quicker inside her. “P…please Yoon Oh, fuck me some more,” she said, almost at her limit.
“I can’t hear you,” he taunted, his hands now snaking on her throat. “More, baby,” he pleaded, giving his all in thrusting into her.
She screamed his names loud and clear, forgetting that her neighbors might hear her screaming another name other than her boyfriend’s. Essie didn’t give a fuck right now – she had to admit that Jaehyun satisfied her sexual desires more than Johnny.
When they both came from their sexual highs, he peppered her whole body with kisses. “You are the best, Jay,” she said, arching her back a little so he could have more access to other areas of her body.
“Really? Am I better than Youngho?” He looked directly into her eyes as he asked this, hoping that she gives him a brutally honest answer.
“Oh, definitely,” she replied, one of her hands ruffling his hair. “You do me like nobody else.”
“I’m glad that you think that way, mon amour,” he said, kissing her inner thigh before hovering over her again. “Let’s take a shower, yes?” When she nodded, he pulled her up and carried her bridal style to the bathroom.
\\\
As much as they wanted to take a bath normally, they couldn’t keep their hands off each other. They had another round inside the shower stall, and unbeknownst to Essie, he came inside her. She couldn’t tell because they were both damp with soap and water, and she was exhausted.
He carried her again toward her bedroom (she still has a separate room in case she doesn’t want to sleep on Johnny’s bed) and both dressed each other. Jaehyun helped her get into a pink slip dress (and no underwear, of course), while Essie dressed him in a pair of boxer shorts and a black shirt.
“Loving you feels like I’m dreaming,” he sang to her as he caressed her cheek. “I can say the same too, darling,” she said, mimicking his action.
“I love you so much, and I wish you were mine for real,” he pressed his forehead on hers and wrapped his arms around her waist. “Oh ma cherie amour, je t'aime tellement que ça me fait mal.”
“Touché, mon cheri,” she replied softly, tilting his chin to look at her. “But I don’t want to think about reality right now. I want to be in this dream with you.”
He responded by kissing her, which felt more comforting than sensual. It was as if she was comforting him that he couldn’t have her, and the only thing he could do was just to give in for now.
–––
FIN
Did you find out the translation of Jay’s badly-translated French statement?
Reality Checklist
Continuing my Jaehyun writings with this angsty piece, inspired by UNIQUE's "Reality Checklist."
I can't help but write him this way; I know he's going to act this out so well. Let's manifest Actor Jaehyun for 2022!

Mahal ko kayong lahat! :)
POV: 3rd person
Word count: 502 words
Additional notes: If this is your first time reading my work, welcome! However, I'll be linking some writing that is in the same timeline like this one since it's part of one of my many unfinished series. Feel free to read those first or read them after this.
Warning: Uh, there's some suggestive content here.
---
He never thought it would affect him like this.
As Jaehyun took another swig of whiskey, he groaned at the thought that he was actually in love. He fell in love with the girlfriend of his best friend, and he risked everything to be with her.
He was currently in a hotel room abroad for a project, and he looked at his room in disdain. It reminded him they had a fancy dinner at a hotel and fucked afterward.
He remembered the way her teeth grazed on his dick and how delightfully painful it was for him. He took another swig of his drink before fishing out a carton of cigarettes in his pocket.
He was never one to smoke often, but tonight felt like the perfect time to do so. He would channel all his thoughts into the smoke he would let out, and hopefully, he could forget about her.
He knew he was a player, but it wasn’t explicitly known by anyone who didn’t know him personally. However, he didn’t show this side to her. She was one of the people he wanted to have, but he never thought he would be invested in her.
Most of the relationships he had were very brief due to his schedule, and most of the time, it was all about fucking. He needed that release, like most guys his age.
But when he met her, especially when they got to know each other better, he observed her well. He knew how to make her ideal coffee, he knew that she didn’t like it when he wore his cap backward, and he knew that she liked to be eaten out. He knew everything there is to know about her, compared to the other women he had been with.
Was there a thrill in being with someone who was taken already? Maybe so, he told himself, as he put out the third stick he was smoking.
His mind now raced to thoughts of how things would have turned out if he got to her first than his best friend. Would he be this observant? Would he care for her more than his ex-lovers?
“Fuck this,” he groaned for the umpteenth time, eyeing the now-empty bottle of whiskey beside him. “I should forget about her. She made her choice already. It’s not me, and it’s never been me.”
He stood up, drawing open the curtains to his dark room. It was already nighttime, and he looked at the bright and bustling cityscape. He has already seen this scenery a couple of times in different countries, and he would usually find this beautiful.
But now, he felt empty. Everyone was moving, yet here he was, still in his thoughts.
He took out his phone in his other pocket and scrolled through the numbers in his contacts. He dialed a number and pressed his phone to his ears.
“Hey, I heard you can get me someone for the night. Can you find me one by 10:30 p.m.? Thanks.”
---
FIN
Dangerous, B-side
Listening to the same song repeatedly can give you different outputs, but this was my initial draft to Dangerous.

I still wanted to share this since I like the tension between Essie and Jaehyun here, so I hope you enjoy this one.
Mahal ko kayong lahat! :)
POV: 2nd person
Word count: 1,040 words (Wow, it's longer than what I've been writing lately lol)
Additional notes: Like with the previous post, I'll be linking some writing that connects to this one.
Warning: Suggestive themes ahead!
---
You knew it would be dangerous to be near Jeong Jaehyun.
You knew the power he held – he was one of the most handsome men you’ve met, and you knew you could give in to anything he asked you to do.
At first, you didn’t really mind him. You were focused on turning down the flirtatious attempts of his best friend, Johnny Suh, who decided to let you know how memorable you were to him when he saw you in Starbucks.
But when you and Johnny decided to become friends, Jaehyun was the first person in his circle of friends that you got to know better.
He was the perfect gentleman, and you appreciated that. You thought he would be a cocky bastard who would use his handsome privileges.
As you got to know more of Johnny’s friends, you didn’t get to hang around Jaehyun that much. But when you did, you started to feel weird around him. Were his looks and gestures getting to you?
You were conflicted since you were also starting to develop feelings for Johnny, despite the not-so-ideal start of your friendship.
You never thought you would feel like this again – falling for two people at the same time. It was bad, but in the end, it was your choice on who you wanted to get together with.
One of the most unforgettable moments you had with Jaehyun was when he kissed you at a party. Your ex was one of the attendees, and you asked him to hide you. He misheard you and pecked you on the lips.
You couldn’t remember what happened after – were you too drunk to recall if you two have already done it? You shut your eyes, trying to recall as much as you could. No, your body didn’t ache when you got home, and you had a good night’s rest.
As you watched Jaehyun grill meat with Taeyong, you couldn’t help but think if you ended up with him instead.
You had shared interests – you loved vinyl records, and you loved drinking wine. You liked his music selection better than Johnny’s, and he was very chill to talk to. He seemed such a calm person who would perfectly complement your feisty personality.
“Penny for your thoughts, Essie?” He asked, flashing you his trademark dimpled smile. “Oh, it’s nothing,” you mumbled, looking away to recover from the embarrassment you felt at looking at him for too long.
“Hey baby, can you help me with this?” You heard Johnny ask from across the room, and you crossed over to where he was. You were thankful he asked you for help because you needed to distract yourself from such tempting thoughts.
You had dinner with Johnny and his friends in your apartment since it’s been a while since all of them got together. Almost everyone had solo projects, and most of them got back to the country recently.
“If someone deserves a solo, it’s you,” Johnny said to Jaehyun, pointing his chopsticks for emphasis.
“Yeah, we agree,” Taeyong and Doyoung chimed in. Everyone else in the room nodded in approval, even you.
Oh, the thought of Jaehyun singing sexy R’n’B songs excited you so much that you felt the familiar wetness on your underwear.
You cursed yourself at this thought and decided to eat more kimchi to forget that sensation.
“Thanks, guys. Maybe soon, I’ll get that project,” Jaehyun said, ears red with embarrassment. Since he was sitting beside you, you were tempted to stroke his red ear and feel how hot it was.
“I’m sure you will; we just have to wait,” you squeaked, slowly looking up from the bowl you have been focusing your attention on.
“Aw, thanks. That means a lot to me, Essie,” his voice was so soft that you thought you were the only one who heard it. Maybe it was really meant for you.
When you looked up from your bowl, he gave you a heartwarming smile. You smiled back, and he touched your wrist. “I look forward to your support, dear,” he whispered.
You could only nod at his response, your body heating up from his touch. You looked away again to see if anyone was observing your interaction but saw that everyone else was involved in their conversations.
It was as if the world stopped, and only you and Jaehyun were having this intimate conversation.
“You keep on looking away from me tonight; is there something on my face that you don’t want to tell me?”
You didn’t expect his words, and when you looked back at him, he tightened the grip on your wrist.
“No, there isn’t anything wrong with your face, Jay! What makes you think there is?” You were beyond flustered, and you could feel your breathing become ragged.
“You aren’t usually like this when we talk,” he loosened his grip now, “and I like it better when the people I talk to can look at me directly on the face.”
You sat up straight and stared at his face. You saw the bags on his under eyes becoming darker and the pimple patches around his nose. When he smiled, you saw there was one more pimple patch underneath his lip.
“Well, fine. You look stressed. I believe you don’t get pimples, yet here you are, wearing pimple patches to a dinner.” You deadpanned, pointing at the patches around his face.
He laughed at your words and swatted your hand away. “It’s normal to have pimples, but I never thought I’d start breaking out now.”
“Don’t be too stressed. You know it’s bad for the health,” you said before going back to eating. “You should take your advice too, honey,” Jaehyun chuckled and mimicked what you were doing.
You rolled your eyes as he also reached for the plate of meat you were holding. “Yeah, you don’t have to remind me of that. Now please, can I have some meat?”
“Jaehyun! Are you teasing Essie?” You heard Johnny comment, probably because he saw how irked you were. Jaehyun let go of the plate of meat and watched you take it for yourself.
No one answered Johnny’s question, and the night continued with everyone catching up on their endeavors.
---
FIN
P.S. That was a lame-ass ending, but my mind stopped working after that. I had to get the tension out of the way hehe.
Guilty
Dear. M made me do this. I'm posting the Jaehyun content I have written so far, and I will continue to write more.

For context, this brain fart is part of the main timeline.
There's something about an angry and heartbroken Jay that makes me want to write more...
Anyway, mahal ko kayong lahat! :)
POV: 3rd person
Word count: 890 approx.
Additional notes: I'm glad I could write the other 127 members in, especially Yuta. I'll make it a goal to include the rest of NCT in my stories when applicable.
---
Yuta felt sorry about how Jaehyun turned out after Essie called off their affair.
When Jaehyun came home from his solo project, he smoked and drank consistently after his schedule. Sometimes he drank whiskey in the mornings and decided to have a pack of cigarettes for breakfast. It was unfortunate that he coped in this way. Although it’s one of the many ways people do so, it is destructive in the long run. Yuta had to intervene; hence, he knew everything there was to know about this week-long rendezvous.
While he took it all in stride, he felt uneasy in knowing what would be one of the dirty open secrets the group now has.
As he watched Jaehyun singing his feelings out in the karaoke booth, he glanced at Taeil. The eldest in the group seemed unaffected by the situation as he flipped through the songbook, looking for another song to sing. It was just the three of them this time – Mark was busy as always, and Jungwoo had more hosting gigs these days.
“Fuck this shit,” Jaehyun growled, yanking the collar of his shirt angrily, “why can’t I still get over her?”
“Let it all out, bro,” Taeil said calmly, scanning intently for the number of the song he wanted to sing. “You’ll get over her eventually.”
“You know, Jay,” Yuta started, “Things are going to be different now, especially if Johnny figures out what you did with his girl.”
“I don’t care,” the youngest groaned, throwing himself on the sofa. “This fucking sucks.”
“Both of you are adults who made this choice, so you’ve got to live with it,” Yuta’s tone was firmer this time. “But that was very dumb of you, Jeong Yoonoh. Why did you even propose that idea to Essie?”
The sound of glass shattering on the floor startled the two older guys, and they saw Jaehyun had just flung the glass of water on the wall. He covered his face afterward, hiding the angry tears flowing on his face.
“You little shit,” Taeil grumbled, looking at the mess he made. “You have to pay for that.”
Jaehyun’s actions were getting on Yuta’s nerves, but he didn’t want to make a commotion. He took deep breaths to calm himself down, not wanting to engage in his friend’s bullshit.
A moment of awkward silence ensued before the heartbroken man spoke. “I thought she liked me. I thought she would choose me. I thought once I have her, I’d stop fooling around.”
Taeil and Yuta looked at each other, loss for words on what to say. They weren’t involved, nor would they like to be involved, in Jaehyun’s affairs. Each had their own lives once the cameras were off, and they tried their best not to get entangled in another’s business.
“You know what, Jay?” The eldest said, sporting a wicked grin on his face. “To make up for your shitty behavior tonight, I’d like you to sing this song with all the emotion you have.”
Like an obedient younger brother, Jaehyun stood beside his hyung and put in the numbers of the requested song. Yuta raised an eyebrow at them both, with Taeil holding his laughter.
“What are you up to?” the Japanese guy mouthed to his former roommate as the singer immersed himself in the song he was about to sing.
“As I’ve said earlier, he has to let it all out.”
When the iconic saxophone intro of George Michael’s (formerly of Wham!) infamous song played from the speakers, Yuta rolled his eyes at Taeil’s suggestion.
Jaehyun gave a memorable performance of the song despite his vocals sounding a bit strained due to all the crying and screaming he did for the past few weeks.
It was during the bridge part that he almost lost it.
“We could have been so good together; we could have lived this dance forever. But now who’s gonna dance with me? Please stay,” the tears pooled once again in his eyes.
The memories were still too fresh for him to forget. Fucking Essie felt so good, and he never wanted to be apart from her. They had intimate dances under the stars and by the shore. It felt surreal, but alas, all good things come to an end. It might be good for him, but it shouldn’t be.
Once he was done singing, he kept to himself on the sofa. His hyungs took their turns singing, and he watched them enjoy what they were doing.
From time to time, Yuta checked in on Jaehyun. It was always the same when they went out to karaoke bars: he would stay still, his eyes looking at nothing until the booze hit him and made him fall asleep.
Every so often, he would wake up and not speak a word until they go off in their respective rooms, or they would have to haul his ass back to his apartment.
This was getting tiring, seeing his downward spiral into depression. Yuta, known for his wise words, knew what they did was wrong. They should be held accountable for their actions. He bet both parties are hot messes right now, but he’s more concerned about Johnny. The tall guy might not take it if he learns about this rendezvous.
Everyone knows no one wants to mess with an angry Johnny Suh.
---
FIN
P.S. Did you expect I was going to let him sing Careless Whisper? Feel free to listen to it below! I think Jaehyun can pull this off flawlessly.